KEGG   Agrobacterium vitis: Avi_2687Help
Entry
Avi_2687          CDS       T00851                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
avi  Agrobacterium vitis
Brite
Enzymes [BR:avi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Avi_2687 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2228948..2229571)
Genome map
AA seq 207 aa AA seqDB search
MVDGQIRTTDVTSHSVLSAFLSVPREAFVPDNLKALAYIDEDIQVAPGRYLMDPSPLAKL
LQLAEIGRSELVLEIGAGTGYVSALLGRLAGAVFAVESDDQLASAAKSNLEKLGAANVTV
VQCPLEAGYAKEAPYDLIFLSGSVEEVPPALFDQLRDGGRLIGVVGSGRAVRAHVFVKAG
GSVSTSSLFNASIKPLPGFEKAREFVF
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggtggacggccaaattcgaacgacggatgtaacctctcattccgtgctttcggctttt
ctgtccgtaccacgggaagcctttgtgccggacaatctgaaagccctggcttatatcgat
gaggatattcaggtcgctcctggccgctatctgatggatccgtcgccgcttgccaagctt
ttgcagctggctgaaattggccgcagcgaactggtcctggaaatcggagcgggcaccggt
tatgtctcggctttgctcggacggctggccggtgcggttttcgccgttgaaagcgatgat
caactggccagtgctgcaaagtccaatcttgaaaagctgggcgctgcgaatgtcacggtc
gttcaatgtccgctggaggctggctatgccaaagaagctccttacgatctgattttcctg
agtgggtcggtcgaggaagtgcctccggcactgttcgatcaattgcgtgacggtggccgt
ttgattggagtggtcggtagcggccgtgccgtccgtgcccatgtcttcgtcaaggccggt
ggttcggtttcgacaagctcgcttttcaatgcttcgatcaagccgcttcccggttttgaa
aaagcgcgcgaattcgtattctga

DBGET integrated database retrieval system