KEGG   Agrobacterium vitis S4: Avi_2819Help
Entry
Avi_2819          CDS       T00851                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
avi  Agrobacterium vitis S4
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avi00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:avi00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2345416..2345937)
Genome map
AA seq 173 aa AA seqDB search
MPKISIVVAVSNNGVIGRNGDMPWKLSTDLKRFKALTLGKPLVMGRKTFESFGSRPLPGR
PHVIVSRHADIAMPSVETVRSLEAGLERAGQIAEDLGGEEICVIGGGEIYRQALPLADVL
HVTHVETQIADGDTVFPAIDPSQFEKLHEEAVPAGERDSFATRYAIYRRKAAL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaaatctccattgtcgttgccgtctcaaacaacggcgtgatcggtcgcaatggc
gacatgccctggaagctgagcaccgatctcaagcggttcaaggcgctgacgcttggcaag
ccactggtaatgggccgcaagacttttgagagtttcgggtcccggccgcttcccggccgc
ccgcatgtgattgtcagccgccacgccgatatcgccatgccctcggtagaaaccgtgcgt
agccttgaggcggggcttgagcgggcagggcagattgccgaagatttggggggcgaggag
atctgcgtgatcggcggcggtgaaatctaccggcaggcattgccgctggctgatgtcctg
catgtcacccatgtggaaacgcagattgccgatggcgatacagtttttccggcaatcgat
ccgtcacagtttgaaaaactgcatgaagaggctgtgccggcgggcgaacgcgacagtttc
gccacgcgctacgcgatctatcggcgaaaagcggctttataa

DBGET integrated database retrieval system