KEGG   Agrobacterium vitis: Avi_2845Help
Entry
Avi_2845          CDS       T00851                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
avi  Agrobacterium vitis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Avi_2845 (pncA)
Enzymes [BR:avi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Avi_2845 (pncA)
    3.5.1.-  
     Avi_2845 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2367241..2367867
Genome map
AA seq 208 aa AA seqDB search
MTKALLLIDIQNGFCPGGNLPVAEGDQIVPIANALMASGSYDLIVASQDWHPANHGSFAS
QHPGAKVFELGELSGKPQMMWPDHCVQGTVDAAFHPGLDLSRIDHVQKKGLNPLVDSYSA
FRDNDQTALTGLGTWLIDKGVTELDVMGLATDYCVKFSVLDALDMLPGVTVRLIVDGSRG
IDPQTVEAAIADMQAHGARLITSADVLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggcgctgcttctcattgatatccagaacggcttttgcccgggcggcaatctg
ccggtggcagagggcgatcagatcgttcccatcgccaatgccctaatggccagcgggtcc
tatgacctgatcgtcgcctcgcaggactggcatccggccaatcacggcagcttcgcctcc
cagcatcccggcgccaaggttttcgaactgggcgagctttccggcaagccgcaaatgatg
tggccggaccattgcgtacaggggacagtggatgccgcgtttcaccccggcctcgacctc
tcccggatcgaccatgtgcagaaaaagggactgaacccgttggtggacagctattcggcc
ttccgcgacaacgatcaaacggccctgactggccttggtacctggctgatcgacaagggc
gtcaccgaactggatgtcatgggccttgccaccgattactgcgtcaagttttccgtgctg
gatgcgctggacatgctgccgggcgttaccgtgcgcttgattgtcgatggcagccggggc
attgatccgcaaacggtggaggcagcgattgccgacatgcaggcccatggcgcacggttg
atcaccagcgcggatgtcctcgcctaa

DBGET integrated database retrieval system