KEGG   Agrobacterium vitis: Avi_3198Help
Entry
Avi_3198          CDS       T00851                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
avi  Agrobacterium vitis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Avi_3198
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Avi_3198
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Avi_3198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2648881..2649360
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSAKDITGRERKLAEFAGKLLLIVNTASKCGFTPQYEGLETLQKRFQDDLVIIGF
PCNQFGGQEPGSEAEIASFCDLNFKVSFPMFAKIDVKGNEAHPLYKYLTHEVRGILGTEA
IKWNFTKFLVGRDGTPIARYAPITKPEEIADDIAKAVKG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttcatgacttttcagccaaggatattaccggtcgggagcgcaagcttgccgaa
tttgccggaaaactgctcctgatcgtcaacaccgccagcaaatgcggcttcacaccgcaa
tatgagggcctggagaccctgcaaaagcgttttcaggacgatctcgtcatcatcggcttt
ccctgcaaccagttcggcggccaggaaccgggatcggaagcggaaattgccagcttctgc
gacctgaatttcaaggtcagcttcccgatgtttgccaagattgatgtgaagggcaacgag
gcccatcctctctacaaatacctgacccacgaagtgcgcggcattctcggcaccgaggcg
atcaaatggaatttcaccaaatttctggtcggccgcgacggcaccccgattgcccgctat
gcgccgatcaccaagccggaagaaattgccgatgatattgccaaggcggtgaagggctaa

DBGET integrated database retrieval system