KEGG   Agrobacterium vitis: Avi_3316Help
Entry
Avi_3316          CDS       T00851                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
avi  Agrobacterium vitis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Avi_3316 (glpK)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Avi_3316 (glpK)
Exosome [BR:avi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Avi_3316 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2740546..2742039)
Genome map
AA seq 497 aa AA seqDB search
MGGFVLAIDQGTTSSRAIVFDGAMRIVGTGQKEFPQIFPQSGWVEHDPDAIWDSVVSSIH
DALARARITAGDLAAIGITNQRETVVVWDKDTGKPIHNAIVWQDRRTSAFCETLKRDGLE
ATVTTKTGLLLDPYFSGTKLSWLLDHVEGARARAEQGGLCFGTVDTYLIWRLTGGKSFVT
DATNASRTLIFNIAEHGWDEELLALLNIPAAMLPEVKDCAADFGVTDKAVFGAAVPILGV
AGDQQAATIGQACFAPGMVKSTYGTGCFALLNTGADRVVSKSRLLTTIAYRMDGKTTYAL
EGSIFIAGAAVQWLRDGLKVIGDAAETGRLAAEADPGQPVYLVPAFTGLGAPWWDPDARG
ALFGLTRNTGPAELARAALEAVCYQTRDLLDAMHKDWQNGEDDMVLRVDGGMAASDWTMQ
RLADLLDAPVDRPSVIETTALGAAFLAASRVGLWPGMDAFARAWARDHRFEPVMDAETRT
EKLRGWRDAVRRTLTAG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggcggttttgtgctggcgattgaccagggaacgacgtcgagccgtgctatcgtgttt
gatggggccatgcggattgtcggcacgggtcagaaggaatttccgcagatcttcccgcaa
tcgggttgggtggagcatgacccggacgccatctgggacagcgtcgtcagctctattcac
gatgcgctggcccgcgcccggatcacggcaggcgatctcgccgccatcggcattaccaac
cagcgggaaaccgttgtggtctgggacaaggacaccggcaagccgatccacaacgccatc
gtctggcaggatcgccgcacatcggctttttgcgaaacgctgaagcgcgatgggctggag
gcaacggttaccaccaaaaccggcctgctgctcgacccgtatttctccggcaccaaactg
tcctggttgctcgaccatgtcgagggtgctcgcgccagggcagagcaaggtggcctgtgc
ttcggaaccgtcgatacctacctgatctggcggctgacgggcggcaaaagcttcgtcacc
gatgccaccaatgcctcgcgcacgctgatcttcaacattgccgagcatggctgggatgaa
gaattgctggcgctgttgaacatccccgccgccatgctgccagaggtgaaggattgcgcc
gccgatttcggcgtgaccgacaaggcggtattcggcgcggcggtgccgatccttggcgtg
gcgggcgaccagcaggccgccaccatcggtcaggcctgctttgctccgggcatggtcaaa
tccacctatggcaccggctgtttcgcgctgctcaataccggcgcggaccgggtggtttcg
aaaagccggttgctgaccaccatcgcctaccggatggacggcaagaccacctatgcgctg
gaaggctcgatcttcattgccggtgccgccgtacaatggctgcgcgatggattgaaggtg
attggtgatgcggcagaaaccggacggctggcggctgaagccgatcccggccagccggtc
tatctggtgccagccttcacgggtctcggtgcgccctggtgggacccggatgcgcgtggc
gcgctgtttggcctgacccgcaatacaggaccggcggaactggcccgcgccgcgctggaa
gcggtgtgttaccagacccgcgacctcctggatgccatgcacaaggactggcagaatggc
gaggacgacatggtgctgcgggttgacggtggcatggcggcctcggactggacgatgcag
cggctggccgatctgctggacgcgccggttgaccgtccgtctgttattgagacgacagca
ctcggtgctgccttccttgcggccagccgtgtcggtctgtggcccggcatggatgcgttt
gcccgcgcctgggcgcgcgaccatcggtttgagccggtcatggatgctgagacccgcacg
gaaaagctcagaggctggcgggatgcggtcagacggacgctgacggcgggttga

DBGET integrated database retrieval system