KEGG   Agrobacterium vitis: Avi_3319Help
Entry
Avi_3319          CDS       T00851                                 

Gene name
bdhA
Definition
d-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
avi  Agrobacterium vitis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Avi_3319 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Avi_3319 (bdhA)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Avi_3319 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2742307..2743077
Genome map
AA seq 256 aa AA seqDB search
MTRTVVITGSTSGIGLGIARAFAAEGANVLINGFGPLGEIESIRKELEAGGGKALYHPAD
MTKPKEIAELVETAIAEFGGIDVLVNNAGIQHVAPVEEFPIDKWDQIIAINMSSAFHTMR
AAIPAMKAKKYGRIINIASAHGLVASPFKSAYVTAKHGILGMTKSVALEVAQSGITVNAI
CPGYVLTPLVEKQIPDTAKARGIAESEVKDVMLHLQATKEFVTVEDIAAMTLYLASDAAK
QITGTSLSIDGGWTAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggactgtcgttatcaccggttccaccagcggcatcgggcttggcatcgcccgc
gcctttgcggctgaaggcgccaatgtgctgatcaacggctttggcccgcttggtgaaatc
gaatcgatccgcaaggaattggaagcgggcggcggcaaggcgctctaccaccccgccgac
atgaccaagcccaaggaaatcgccgaactggtggaaaccgccatcgccgaattcggcggc
atcgatgttctcgtcaacaatgcgggcattcagcatgtcgctcccgtcgaggaatttccc
atcgacaaatgggaccagatcatcgctatcaacatgtccagcgccttccacaccatgcgc
gccgccatcccggcgatgaaggcgaaaaaatatgggcggatcatcaatatcgcctcggcc
catggcctggtcgcctcgccgttcaaatccgcctatgtcaccgccaagcacggcattctc
ggcatgaccaagtcggtggcgctggaagtggcgcaaagcggcattaccgtcaacgccatc
tgccccggctatgtgctgacgccgctggtggaaaagcagattcccgataccgccaaggcg
cgcggcattgccgagagcgaggtcaaggatgtgatgctgcatttgcaggccaccaaggaa
ttcgtcaccgtcgaggacattgccgccatgacactctatcttgccagcgatgcggcaaag
cagatcaccggcaccagcctatccatcgacggcggctggacggcgcagtaa

DBGET integrated database retrieval system