KEGG   Agrobacterium vitis: Avi_3364Help
Entry
Avi_3364          CDS       T00851                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
avi  Agrobacterium vitis
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Avi_3364
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Avi_3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2786442..2788658)
Genome map
AA seq 738 aa AA seqDB search
MSSKKVSAPAEEIVNPGSVSQTVYDTIIIGSGFGGSVAALRLCEAFQNVNYSATAGKPVL
LLERGKDWWGNLTGQPTKAPPFSNYRQPDGRAGWMMDLEPFGTPQSPPDTYGQPEELDGE
TANFNTMTTYAQRPIPVYPGLVEMIVAYPPPPPEPVPDAPAPTPTMTTIVGAALGGTSHV
YNTFFQKPSQLAFTLAFRDPEKLDSYESVLLSYGELAQHYDTVEKMMEPKTIDDKDNMVT
ETVPVREKPVFTYALKRSPPYLSTRSFRKQVKKIEDAVRLSKVETPIKSVQLEYTKLALD
WSVVCKEVEVEMLPSAIIGEMWYGMNSYSISKTPSEGQELLGVKKALDQNYLKQAKDTGL
LDIRCLSNVTNVYQDPNSDKDSPIYVINVEQIAPTDVANPTLLVYRAKNVIFSAGSMHTA
SMLLEYSNNPNPEAPDTKGLPALSKYVGKFWGQNGDVTGTQDLSIKTRPSDGGPGSTDAS
FYFVNDDTLNGITLPDDELEAAFNQSIDYMKVNKSASFIRLMLYPAWYDEADNLQNTYNM
SVCYQPAPGEFLVDPASDKSSGRKVYSLYYPNTPTEKDEGAEPTEVGDINVGVLDSVNAL
TTVLTTWGEVNASKEGESLTRRNGPLTYRGPLPALQSTRLHHARSLEGWDPKRVPEEFVV
AYGVTAHPLGGCVLGKACNKHGQVLAADNETAVPGLYVVDGSLIPGSTGAATPAWTIAAV
AEYCMTKITGNIVGTTQQ
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
gtgtcttcgaaaaaagtttcggcgcctgccgaagaaatcgtcaatcccggaagcgtcagc
cagactgtttatgatacgatcatcatcggctccggcttcggcggcagcgtcgccgcgctc
aggctgtgcgaggccttccagaacgtcaattattcggctactgcaggcaagcccgtgctg
ctgctggagcgcggcaaggactggtggggcaatctgacaggccagcccaccaaagcgccg
ccgtttagcaactatcgccagccggatggacgcgctggctggatgatggatctcgagccg
ttcggcacgccgcaatctccaccggatacctatggccagcccgaggagttggatggcgag
acggccaacttcaatacgatgaccacctatgcgcagcgtccgatcccggtctatcccggc
ctggtggaaatgatcgttgcctatccgccaccgccgccggagccggtgccggatgctccc
gccccgacaccaaccatgaccaccatcgttggcgcggcgctcggcggcacctcgcatgtc
tacaataccttcttccagaagccgtctcagctggccttcaccctggccttccgcgatccc
gagaagttggactcctacgagagtgtactgctgtcctatggcgaactggcgcagcattac
gacaccgtcgagaaaatgatggagcctaaaaccatcgatgacaaggacaacatggtgacg
gagacggtgcccgtcagagagaaaccggtctttacctatgcgctcaagagaagcccgccc
tatctttccactcgcagcttcaggaagcaggtcaagaaaatcgaagatgctgtccggttg
agtaaagtcgaaacgccgattaagtcggttcaactggaatataccaagctggcgctcgac
tggagcgtggtgtgcaaggaagtggaagtcgaaatgctgccctccgccatcatcggcgaa
atgtggtatgggatgaacagctattcgatctcgaagacgccgtcggaaggccaggaattg
ctcggcgtcaagaaggcgctggaccagaattacctcaagcaggccaaggacaccggcctg
cttgacattcgttgcctgagcaatgtcaccaatgtctatcaggacccgaattccgataaa
gacagcccaatttatgtcatcaatgtcgagcagatcgcaccgaccgatgtcgccaatccg
acactgctggtctaccgggcgaagaacgtgatcttctccgccggctccatgcatacggca
tcgatgctgctggaatattccaacaatcccaatccagaggcacctgacaccaaaggcctg
ccagctctgagcaaatatgttggcaagttctggggccagaatggcgatgtcaccggcact
caggacctgagcatcaagacgcggccttcggatggcggtcccggttcgaccgatgcctcc
ttctatttcgtcaatgacgacaccttgaatggcatcacccttccggatgacgagttggag
gcggccttcaatcagtcgatcgactacatgaaggtcaataaatcggcgtctttcattcgc
ctcatgctctatccggcctggtatgacgaagccgacaatctgcagaacacctataatatg
tcggtctgctaccagccggcgccgggcgaattcctcgtggatccggcttcggacaagtct
tcgggccgcaaagtctacagcctgtattatcccaatacgccgacagagaaggacgagggg
gcggagcctaccgaggttggcgatatcaatgtcggcgtgctggattcggtcaatgcgctc
accacggtgctgaccacatggggagaagtcaatgccagcaaggagggcgagagcctgacc
cggcgcaatggaccgctcacctatcgtggcccgctgccagcgctgcaatcgacccggttg
catcacgcccgaagcctggaaggctgggaccccaaacgcgtgccggaggaattcgtggtg
gcctatggcgtcacggcccatccgctcgggggctgcgtgctgggcaaggcctgcaacaaa
cacggccaggtcttggcagccgacaacgagacggcggtgccgggcctctatgtggttgat
ggttctttgatccccggttccaccggtgccgcgaccccggcatggaccattgccgccgtg
gccgaatattgcatgacgaaaatcaccgggaatatcgtcggcaccacgcagcagtga

DBGET integrated database retrieval system