KEGG   Agrobacterium vitis: Avi_3740Help
Entry
Avi_3740          CDS       T00851                                 

Gene name
pldB
Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
avi  Agrobacterium vitis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Avi_3740 (pldB)
Enzymes [BR:avi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Avi_3740 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3104754..3105752
Genome map
AA seq 332 aa AA seqDB search
MLHAVDGNPIPDNHHAGFFTSYDGLRLRYAIFKSDISPAKGTVVLVHGRSESIEKYFETI
RDLTAAGLWVATFDLRGQGLSDWTLLQKSSKPRGDKEKRWGHVQRFSDYERDLEQFLEQV
VLPDCRLPFSMIAHSTGGLIALAAAPRLSGRISRLVLSAPFVGLHGEALSAAKVFALARL
ASTLGLGNRPLSSASKPHTFATNVLTSDAARFDRNMAIFAAVPELSISAPSARWLHECAK
AIRRVNDPAHLTGITIPTLLLAPMLDGVVPFSAQEHLARHFRAAQLLSIPGARHEVLQEQ
DRYREQALAAIHAFIPGSDPMQIEGEAELVGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcatgccgtggacggcaatcccattcccgacaatcatcacgccggctttttcacc
agttacgacggccttcgcctgcgctatgcgatcttcaagagcgatatcagcccggccaaa
ggcacggtcgtgctggtgcatggccgcagcgaatccatcgagaaatattttgaaaccatc
cgcgacctgacagcagcgggcctttgggtcgctaccttcgacctgcgcggccaaggcctg
tccgactggacacttctgcaaaagtcctcaaaacccagaggggataaggaaaaacgctgg
ggccatgtccagcgcttttccgattatgagcgggatctggagcagttcctggaacaggtc
gtgctgccggattgtcgcctgccgttctcgatgatcgcccattccaccggtggattgatc
gcccttgccgcagcaccacggctgtccggacgcatttcgcggctggtcctgtcagccccc
tttgtcggcctgcatggcgaagccctatcggcggcaaaggtgttcgcgctggcgcggctg
gcatcaacgctcgggcttggcaaccgtcccttgtcatcagccagcaagccgcacaccttt
gccaccaatgtcctgacctcggatgccgcccgcttcgaccggaatatggcgatttttgcc
gctgtgccggagttgtcgatcagcgcgccttcggcccgctggctgcatgaatgcgcaaaa
gccatccggcgggtcaacgatcccgcccatctgacggggatcaccattcccaccctgttg
ctcgccccgatgctggacggcgtcgtgccctttagcgcgcaggaacacctggcccggcat
ttccgcgccgcgcaattgctgtccattcccggcgcccgccatgaagtgttgcaggaacag
gaccgctaccgcgaacaggcgcttgcagccatccatgccttcattcccggcagcgatccg
atgcagatcgaaggcgaggcagaactcgtcggtctttga

DBGET integrated database retrieval system