KEGG   Agrobacterium vitis: Avi_3802Help
Entry
Avi_3802          CDS       T00851                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
avi  Agrobacterium vitis
Brite
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Avi_3802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3163354..3164718
Genome map
AA seq 454 aa AA seqDB search
MAVFNEKSRLPLLALALLSLAFAGLGWAAQTLAETPTQAETGAPAQLSAVAQLGKALFFD
QSLSGSGRMSCASCHDPAHHYAPANTQAVQMGGPDLNLPGIRPVPSLAYKIATPGFSVGV
ENAAEEAQEASPMAEASGTALAAQTAVIAGPVAGQPLVKAVAAADNAVPQGGMFWDGRAD
SLEDQALGPLLSPFEMANSDAQALYDKIKAGYGAQLTALFGKQVAEDQSMALSEIGFALA
RYQVEDPSFHSYSSKYDAYLRRQTQLTAAEQRGLALFDDPKKGNCASCHLDKMGGDGQMP
AFTDYEFEALGVPRNPDIPTNANRLYFDLGICGPMRHDEFSAQPQNCGLFKTPTLRNVAE
RGVYFHNGVYKTLEEATRFYVARDTDPASIYPKNPDGSIDKFNDMPDAYRGNIDVIDAPM
DRKPGQPPALNETEIRDVVAFLKTLTDGWGAQQR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgtttaacgaaaaatcccgcctgccgctgctggcgttggcgcttctgagcctt
gccttcgcaggcttaggctgggcggcccagacattggcggaaaccccgacacaggccgaa
accggcgcacccgcccagctcagtgccgtggcacaattgggcaaggcgctgttcttcgat
cagagtctgtctggtagtggcaggatgtcctgcgctagctgccatgatcccgcccatcat
tacgccccagccaacacgcaggcggtacagatgggtggacccgatcttaacctcccgggt
atccgccccgtgccaagccttgcctacaagatcgccacgcctggcttctctgtgggcgtg
gaaaatgccgccgaggaggcgcaggaggcttcgccgatggcagaagcttccggcacggca
cttgccgcgcaaactgcggtgatcgccgggccggtcgctggccaacctctcgtcaaagcc
gtggctgccgccgacaatgccgttccccagggcggcatgttctgggatgggcgcgccgac
agtctggaagaccaggcgttggggccgcttttgtcgccctttgaaatggccaatagcgat
gcgcaggccctctatgacaaaattaaagccggatatggcgcgcaactgacggccttgttc
ggcaaacaggttgcggaggaccaatccatggccttgtcggaaatcggttttgcattggcc
cgctatcaggtggaagacccgtccttccattcttattccagcaaatacgatgcctatctg
cgcagacagacgcaacttactgcggctgaacagcgtgggctcgccttgttcgacgatccg
aaaaaaggcaattgcgcctcctgccacctggacaaaatgggcggcgacggacagatgccg
gcatttaccgattacgaattcgaggcgctcggcgtgccgcgcaatcctgatattcccacc
aatgccaacaggctctatttcgatctcggcatttgcggcccgatgcgccatgacgaattt
tccgcccagccgcaaaattgcgggctgttcaagaccccaaccctgcgcaacgtcgccgag
cgcggtgtctatttccacaatggcgtttacaagacgctggaggaggccactcgtttttac
gtggcccgtgacaccgatcctgccagcatttatccaaaaaatccggatggcagcatcgac
aagttcaacgacatgccagatgcctatcgcggcaatatcgatgtgatcgatgcgcccatg
gacagaaagccgggccaaccgcccgcattgaacgagacggaaatcagggatgtcgtggct
tttttgaaaacactgaccgatgggtggggtgcgcagcaacgctag

  All links  
No link information was found.   
DBGET integrated database retrieval system