KEGG   Agrobacterium vitis S4: Avi_3832Help
Entry
Avi_3832          CDS       T00851                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
avi  Agrobacterium vitis S4
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:avi00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:avi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3183055..3184362)
Genome map
AA seq 435 aa AA seqDB search
MSTGFFGDITKIKYEGPDSTNPLAFRHYNPDEVVMGKRMEDHLRFAVAYWHTFVWPGTDP
FGGNTFERPWFKDSMEAAKLKADVAFEFFQLLGTPYYCFHDADARPEGASFAENTKNLNE
IVDYFAQKQADTGVKLLWGTANMFSHRRYMSGAATNPDPDVFAFAAATVKTCLDATQKLG
GENYVLWGGREGYETLLNTDLKQELDHMGRFLNMVVEYKHKIGFKGAILIEPKPQEPSKH
QYDYDVATVYGFLKTYGLEKEVKVNIEQGHAILAGHTFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYQVLQAGGFTSGGTNFDSKLRRQSIDPADLLIGHIGGMD
CCARGLKAAAKMVEDKALSGPLANRYAGWNSDGAKAMLASGTLESIAARVEGENINPQPV
SGQQELLENVVNRYV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaggctttttcggcgacatcaccaagatcaaatatgaaggccctgacagcacc
aatccgctggccttccgccactataaccccgatgaagtggtgatgggcaagcggatggag
gaccatctgcgttttgccgtggcctactggcacaccttcgtgtggccgggcaccgacccg
ttcggcggcaatacgtttgagcgtccttggttcaaggattcgatggaggctgccaagctg
aaggccgatgtggcctttgaattcttccagttactcggcacgccttactattgcttccat
gatgcggatgcgcgtcctgaaggcgcgtcctttgcggaaaataccaaaaatctcaatgag
attgtcgattactttgcccaaaagcaggccgataccggcgtcaagctgttgtggggtacg
gccaacatgttctcgcatcgtcgctatatgtcgggtgccgccaccaacccggaccctgac
gtctttgcctttgccgccgcaaccgtcaagacttgcctggatgccacccagaagctgggc
ggcgaaaactacgtgctgtggggtggccgtgaaggctatgaaaccctgctcaacactgac
ctgaaacaggaactggaccatatgggccgtttcctcaacatggtggtggaatacaagcac
aagatcggcttcaagggcgcaatcctgatcgagccgaagccgcaggagccttccaagcat
cagtatgattatgatgtggccaccgtctacggcttcctcaagacttatggtctggagaag
gaagtgaaggtcaatatcgagcagggccatgccattctggccggtcatacgtttgagcat
gaactggcgctggccaacgcgctgggcattttcggttccatcgacatgaaccgcaatgac
tatcaatccggctgggatactgaccagttccccaacaacgtgccggaaatggcgctggcc
tattatcaggtcctgcaggcgggtggctttacctccggcggcaccaatttcgatagcaag
ctgcgccgccagtccatcgacccggcggatctgctgatcggccatatcggcggcatggat
tgctgcgcccgtggcctgaaggcggctgcgaaaatggtggaagacaaggctctgtccggc
ccgcttgccaaccgttatgcaggctggaatagcgacggcgccaaggccatgctggccagc
ggcacgctggaaagcattgcggcccgcgttgaaggcgaaaacatcaatccgcagccggtc
tccggtcagcaggaattgttggaaaacgtcgtcaatcgctacgtctga

DBGET integrated database retrieval system