KEGG   Agrobacterium vitis: Avi_4083Help
Entry
Avi_4083          CDS       T00851                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
avi  Agrobacterium vitis
Pathway
avi00900  Terpenoid backbone biosynthesis
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Avi_4083 (dxr)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Avi_4083 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ACM37952
UniProt: B9JTP4
Position
1:3433799..3434992
Genome map
AA seq 397 aa AA seqDB search
MNTATSQPRRLTILGSTGSIGTNTLDVIRQMGGRDRFDIMALTGHGNVALLAEQALVTGA
RLAVTSDENQYIALKDLLSGSGIDVAAGSSGLQEAACLEADWVMAAIVGTAGLQPTLTAA
ARGADIALANKECLVSAGELFIETVRKGGGKIIPVDSEHSAIFQCLDENHRDTLERIVLT
ASGGPFRTFTRQQMADVSVQTARAHPNWSMGLKVSIGSASMFNKALEMIEAKHLFDLTPD
QIEVIVHPQSIIHSMVGYSDGSVLAQLGVPDMRTAIGYALSYPKRAALDVDRLDFTKLAR
LDFEAPDLDRFPAIRLARTALERGGLQGAVLNAAEECAFEAFVEEKIGFLAMADVVEDVM
DHLSGLAPATVIADVFAADAQARRRAQEVILNQGRTR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgccacgtcccagccccgccgcctcaccattctggggtcgaccggctctatc
ggaaccaacacgcttgacgtgatcagacaaatgggcggacgcgatcgcttcgacatcatg
gccctgacagggcacggcaatgtcgctcttctggcggagcaggcactggtgacaggcgca
aggctggcagttacctctgatgaaaatcaatatattgccttgaaagacctgttatcgggc
agcggcatcgatgttgcagccggcagcagcgggctacaggaagcagcatgccttgaggcg
gactgggtgatggccgccattgtcgggaccgccggtttgcagccaaccttgacagccgcc
gcacgcggcgccgatatcgcgctggccaataaggaatgcctcgtttcggctggcgaattg
ttcatcgagacggtgcgtaagggcggcggcaagattatccccgtcgatagtgagcattcg
gcaattttccaatgcctggacgaaaatcaccgtgacacgctggagcggattgtgctgacg
gcttctggcgggccgtttcgcaccttcacccgccaacagatggctgatgtcagtgttcaa
accgcccgcgcccatccgaattggtccatgggactgaaggtgtcgattggcagcgcctcg
atgttcaacaaggcgctggagatgatcgaggccaagcacctgttcgatctgacacccgac
cagatcgaggttatcgtccatcctcaatcgatcatccactccatggtgggctatagcgac
ggctccgtgctggcccagcttggcgtaccggatatgcgcaccgccatcggttatgcgctg
agctatccgaaacgcgcggcgctggatgtggaccggttggattttaccaagctggcgcgg
ctggatttcgaagcgccggacctggaccgttttccggccatccgtctcgcccgtacagcg
cttgagcgcggcggcttgcagggcgccgtgctgaacgccgccgaagaatgtgcctttgag
gcttttgtcgaggaaaaaatcggttttctcgccatggccgatgtggtcgaggatgtcatg
gatcatctatcgggcttggcaccggcgaccgtgattgccgatgtctttgccgccgatgcg
caggcacgacgccgagcccaagaggtcatcctgaaccaaggccgcacgcgataa

DBGET integrated database retrieval system