KEGG   Agrobacterium vitis: Avi_4127Help
Entry
Avi_4127          CDS       T00851                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
avi  Agrobacterium vitis
Pathway
avi00020  Citrate cycle (TCA cycle)
avi00640  Propanoate metabolism
avi00660  C5-Branched dibasic acid metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01200  Carbon metabolism
Module
avi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Avi_4127 (sucC)
   00640 Propanoate metabolism
    Avi_4127 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Avi_4127 (sucC)
Enzymes [BR:avi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Avi_4127 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACM37986
UniProt: B9JTS8
Position
1:complement(3480927..3482123)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKALLKSFGAPVAEGVAIFSADEAEAAAKQLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAFSIDEVKSHVAEMLGNTLVTNQTGPAGKQVNRLYIEDGADIERELYL
SLLVDRAVGQVAFVVSTEGGMDIETVAHDTPEKIISVAIDPEAGVTAANLEALTAALLLE
GEAKADAEKLFPILYKAFVEKDMALLEVNPLIVMKNGRMRVLDAKMSFDGNALFRHEDVV
ALRDKTEEDAKEIEASKYDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTAAFKIITADPAVKGILVNIFGGIMKCDVIAEGVLAAVKDVGLTVPLVVRLE
GTNVELGKKIINESGLNVISADDLDDAAQKIVAAVKAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaggccaaggctctgctgaagagctttggcgcaccggttgcc
gaaggtgtggcaatcttttccgccgatgaagccgaggcggccgcaaagcagcttcctggc
ccgctttatgtcgtcaagagccagatccacgctggtggtcgcggcaagggcaagtttaag
gaactcggcccggatgccaagggcggcgttcgcctggcgttctcgatcgatgaagtgaag
tcgcatgttgctgaaatgctcggcaacacgctggtgaccaaccagaccggccccgctggc
aagcaggtgaaccgcctgtatattgaagacggtgctgatatcgagcgcgaactttatctg
tcgctgctcgtcgaccgcgctgttggtcaggttgctttcgtggtctccaccgaaggcggc
atggacattgaaacggttgctcacgacaccccggaaaagatcatcagcgttgcgattgat
ccagaagctggtgtaacggctgccaatctcgaagccctgactgcggctttgctgctcgaa
ggcgaagccaaggctgacgctgaaaagctgttcccaatcctgtacaaagcctttgtcgaa
aaggacatggcgcttctggaagtgaacccgctgatcgtcatgaagaacggtcgtatgcgc
gttctcgatgccaagatgtccttcgacggcaacgccctgttccgccacgaagatgtggtg
gctctgcgcgacaagaccgaagaagacgccaaggaaattgaagcctccaagtacgatctg
gcttatgtcgcgctcgatggcaatatcggctgcatggtcaatggcgcaggtcttgccatg
gcaaccatggacatcatcaagctctacggtgctgagccggcaaacttcctcgacgttggt
ggcggcgcgaccaaggaaaaggtaacggcagccttcaagatcatcactgccgatccggct
gtgaagggcattctggtcaacatcttcggcggtatcatgaagtgtgacgtgattgccgaa
ggcgttctggctgccgtcaaggacgtcggcctcaccgttccactcgttgttcgcctcgaa
ggcaccaatgtcgagctgggcaagaaaatcatcaacgaatccggtctcaacgtcatttcg
gcggatgatctggacgatgctgcgcagaagatcgtcgcagccgtgaaggcagcgtga

DBGET integrated database retrieval system