KEGG   Agrobacterium vitis: Avi_4136Help
Entry
Avi_4136          CDS       T00851                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
avi  Agrobacterium vitis
Pathway
avi00020  Citrate cycle (TCA cycle)
avi00190  Oxidative phosphorylation
avi00650  Butanoate metabolism
avi01100  Metabolic pathways
avi01110  Biosynthesis of secondary metabolites
avi01120  Microbial metabolism in diverse environments
avi01130  Biosynthesis of antibiotics
avi01200  Carbon metabolism
Module
avi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
avi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
avi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Avi_4136 (sdhD)
   00650 Butanoate metabolism
    Avi_4136 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Avi_4136 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ACM37992
UniProt: B9JTT4
Position
1:complement(3488197..3488577)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKDGTEHFWRQRLTAIANVPLMLFFIIFMLTHAGAPYADVVSALS
NPLVAVIMGLVVLSGLIHMKIGMQEIIADYIHNEVMKMGLMMLNTFFVVITGALCLFAIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgtacaccgctcggtaaagttcgcggtctcggctccgcaaaggacggcacg
gaacatttctggcgccagcgcctgacggccatcgccaacgtgccgctcatgctgttcttc
atcattttcatgctgacccatgccggcgcaccctatgccgatgtcgtgtccgctttgtcg
aaccctctcgtggcggttatcatgggactggtcgtgctttccggcctgatccacatgaag
atcggcatgcaggaaatcatcgccgactatattcataacgaagttatgaagatggggctg
atgatgctcaacacatttttcgtggtcatcacgggtgcgctctgtcttttcgccatcctc
aagatcgcgtttgtaggataa

DBGET integrated database retrieval system