KEGG   Agrobacterium vitis: Avi_4136Help
Entry
Avi_4136          CDS       T00851                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
avi  Agrobacterium vitis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avi_4136 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Avi_4136 (sdhD)
   00650 Butanoate metabolism
    Avi_4136 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Avi_4136 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3488197..3488577)
Genome map
AA seq 126 aa AA seqDB search
MDMRTPLGKVRGLGSAKDGTEHFWRQRLTAIANVPLMLFFIIFMLTHAGAPYADVVSALS
NPLVAVIMGLVVLSGLIHMKIGMQEIIADYIHNEVMKMGLMMLNTFFVVITGALCLFAIL
KIAFVG
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatatgcgtacaccgctcggtaaagttcgcggtctcggctccgcaaaggacggcacg
gaacatttctggcgccagcgcctgacggccatcgccaacgtgccgctcatgctgttcttc
atcattttcatgctgacccatgccggcgcaccctatgccgatgtcgtgtccgctttgtcg
aaccctctcgtggcggttatcatgggactggtcgtgctttccggcctgatccacatgaag
atcggcatgcaggaaatcatcgccgactatattcataacgaagttatgaagatggggctg
atgatgctcaacacatttttcgtggtcatcacgggtgcgctctgtcttttcgccatcctc
aagatcgcgtttgtaggataa

DBGET integrated database retrieval system