KEGG   Agrobacterium vitis S4: Avi_4157Help
Entry
Avi_4157          CDS       T00851                                 

Definition
secreted alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
avi  Agrobacterium vitis S4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:avi00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:avi00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:avi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3504613..3506193)
Genome map
AA seq 526 aa AA seqDB search
MSTSFKALSRRSFLLGTSAAGLAAGSGLALPFYARAADRPVFTHGVQSGDVDLNSGMIWT
RVDRPSRIMMEYSTTESFANPVRLPALNALPDSDYAVKRLLADLPSDQEIFYRFTAADLS
HINSVSEPIIGRFRTAPASRRDVRFVWSGDTVGQGWGIDETGMKTYATMAKHQPDFFLHS
GDTIYADGPLKEEVDLKDGTKWKNVVVTDEKRKVAETLDEYRGQWKYNMMDKNVLELSAI
CPTHYQWDDHEVLNNWSSGKDLTADSRYSEKSIALLSARAARAFHEMTPIRYTPAEPGRV
YRKISHGPLVDVFFLDMRSYRGSNHDGMETVQTPESRILGAEQVAWLKRELTNSKATWKI
IAADMPLGLIVWDDFLNKKGTEAVAQGHNGEPRGRELEIAELLRHMKMTGIRNTVWLTAD
VHYTAAHYYNPDKAAFQDFDPFWEFVSGPLHAGTFGPSDLDMTFGPELKFVKAPTAEQGQ
NLPPSAGLQFFGIVDVDGVSEQLSVRLMDRDDNELYKVVLDPVRSA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtccacatccttcaaggcgctgagccgccgttcgtttctgctcggcaccagtgctgcc
gggcttgctgccgggtccggtctggcgctcccgttttatgcccgggcggcggaccgcccc
gttttcacccacggtgtccaatccggcgatgtcgatctgaattccgggatgatctggacg
cgggtagaccgcccttcgcggatcatgatggaatattccaccaccgaaagctttgccaat
ccggtgcggttgcctgccctcaatgcgctgccggatagtgactatgcggtgaagcggctt
ttggcggacctcccgtccgatcaggagattttctatcggttcacggcggctgatctttcc
catatcaacagtgtctcggaaccgatcatcggccggttccgcacagcgcccgcttcccgg
cgtgatgtccgcttcgtctggtcgggtgacacggtgggccagggctggggcatcgatgaa
accggcatgaagacctatgccacgatggccaagcatcagccggatttctttctgcattcc
ggcgacaccatctatgccgatggtcccctcaaggaagaggtcgatctgaaggacggcacc
aaatggaaaaatgtcgtggtcaccgatgaaaagcgcaaggtggcagaaacgctggacgaa
tatcgcggccagtggaaatacaatatgatggacaagaacgtgctggagctgtcggctatt
tgtccgacccattaccagtgggacgatcacgaagttctgaacaactggtcctcaggcaag
gatttgacagccgacagccgctatagcgaaaaatccatcgctcttctgtcggcgcgtgcc
gcccgtgccttccatgaaatgacgccgatccgctacacgcctgccgagccgggccgggtt
tatcgcaagatttcccacggtccgctggtcgatgtgtttttcctcgatatgcgtagctat
cgtggttccaatcacgacggcatggaaacggtccagacgccggaatcgcgcatcctcggg
gccgagcaagtggcctggctgaagcgggagctgaccaattccaaggcaacctggaaaatc
atcgccgccgacatgcctttgggcctgatcgtctgggacgactttctcaacaagaaaggc
acggaagccgtggcccagggccataatggcgagccgcgtggccgtgagctggaaattgcc
gaactgctgcggcatatgaagatgacaggcatccgcaacaccgtctggctgacagcggat
gtgcattataccgctgcccattactacaatcctgacaaggcggctttccaggattttgac
ccgttctgggagtttgtctccggtcctctgcatgcaggcacgttcgggcccagtgatctg
gacatgaccttcgggccggagctgaaattcgtcaaggcaccgacggcggagcagggccag
aacctgccgccgtcagcagggcttcagttcttcggcatcgtcgatgtcgatggcgtgagc
gaacagctcagcgtgcggctgatggaccgggacgataatgagctttacaaggtcgtgctc
gatccggtgcgcagcgcctga

DBGET integrated database retrieval system