KEGG   Agrobacterium vitis: Avi_4178Help
Entry
Avi_4178          CDS       T00851                                 

Definition
esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
avi  Agrobacterium vitis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Avi_4178
Enzymes [BR:avi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Avi_4178
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Avi_4178
Lipid biosynthesis proteins [BR:avi01004]
 Fatty acid synthase
  Component type
   Avi_4178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3518182..3518949)
Genome map
AA seq 255 aa AA seqDB search
MGFKPVPLQFAVIVVASLLAGGSFALPSVAQEQAPQGQPAEQSMPDQPPADQSMPEDATG
DTPVAEAQVQLIGLGDSLMAGYQLQGDEALTSQLEKALHDKGMNVSIGNAGVSGDTTEGG
LARVDWSVPDGTQGVILELGANDALRGIAPEESEKNLAAIIEKLQARKIGVLLVGMIAPP
NMGADYAKRFNPIYQRLAEKYKIPLYPFILEGVVTDATLKLGDGMHPNAKGVGVMVEHML
PAVQSFAKGLEDKVN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggttttaaacctgtcccccttcaattcgccgtcatagtggtggctagcctgctcgca
ggcggtagttttgccctgccgagcgtcgctcaggaacaggctccgcaaggccagccagcg
gaacagtccatgcctgatcagcctcccgcggaccagtccatgccggaggatgcaacgggg
gatacgccggtggcggaagcgcaagtgcaattgatcgggcttggtgacagcctgatggcc
ggctatcagcttcagggcgacgaggccttgacgagccagctggaaaaagccctgcatgac
aagggcatgaatgtcagtatcggcaatgcaggcgtgtccggcgataccacggaaggcggg
ctggcgcgggttgactggtcggtgccggatggaacgcagggcgttatcctggaacttggc
gccaacgatgcgctgcgcggtattgcgccggaagagagtgaaaaaaacctggcggcgatc
atcgaaaaattgcaggcccgcaagattggcgtgctgctggtggggatgattgcgccgccc
aatatgggggcggattatgccaagaggtttaatccgatctatcagcgtctggctgaaaaa
tataaaattccgctttatccctttatccttgagggcgtcgtgactgatgccacgttgaaa
ctgggcgatggcatgcatcccaacgccaagggcgtgggggtgatggtcgagcatatgctg
cccgccgtccagagtttcgcgaaaggtttggaggataaggtgaattaa

DBGET integrated database retrieval system