KEGG   Agrobacterium vitis: Avi_4281Help
Entry
Avi_4281          CDS       T00851                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
avi  Agrobacterium vitis
Pathway
avi00330  Arginine and proline metabolism
avi00332  Carbapenem biosynthesis
avi01100  Metabolic pathways
avi01130  Biosynthesis of antibiotics
avi01230  Biosynthesis of amino acids
Module
avi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Avi_4281 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Avi_4281 (proB)
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Avi_4281 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACM38101
UniProt: B9JUH8
Position
1:complement(3597959..3599137)
Genome map
AA seq 392 aa AA seqDB search
MSAPLASLSHYKRIVIKIGSALLVDRGAGLKHAWLDAVCDDIAALRAKGVEVLVVSSGAI
ALGRTVLNLPGGALKLEESQAAAAVGQIALARHWSESLSRSSIVAGQILLTLGDTEERRR
YLNARATISQLLKLGAVPIINENDTVATTEIRYGDNDRLAARVATMTGADLLILLSDIDG
LYTAPPHLDPEAKLLPVIAEITPEIEAMAGGAASELSRGGMRTKIDAGKIATSAGCAMII
TSGKLLNPLRGIDEGAAHSWFAPSAMPVTARKTWIAGQLQPAGILSVDAGAETALRAGKS
LLPAGVREVSGHFHRGDTISVVGLEGREIARGLAGYDADEARRIAGHKSAEIEALLGYAG
RSAMIHRDDLVMTEQTGRKAGKSTKKKDEAHA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccgcttgcctctctctcgcactataagcggatcgtcatcaaaatcggctcg
gccctgctggtggaccggggggccggcctgaaacatgcctggctcgatgccgtctgtgac
gatatcgccgccctgcgcgccaaaggtgtcgaggtgctggtcgtgtcgtctggcgctatt
gcgcttggccgcacggtgctgaacctgccggggggggccttgaagctggaagaaagccag
gcggcggcagccgtcgggcaaattgctctggcgcggcattggtcggaaagcctgtcgcgg
tcatccattgttgctggccagatcctgctgacgctgggggatacggaggagcgccgccgc
tatctcaacgcgcgcgccacgatcagccagttgctgaagctgggggcggtgccgatcatc
aacgaaaatgacacggtggcgaccaccgaaatccgctatggcgataatgatcggctggcc
gcccgggtggcaacgatgaccggtgccgatctgctgatcctgctctcggatatcgatggt
ctttataccgcgccaccgcatcttgatcctgaggcgaaacttctgcctgtgattgccgaa
atcacccctgaaattgaggcgatggcgggcggtgcggcctcggaattgtcgcgcggcggc
atgcgcaccaagatcgacgcgggcaagattgccacaagtgccgggtgtgcgatgattatc
acatcgggcaagctgctcaatccgttgcgcggcattgatgagggggcggcgcattcctgg
ttcgcgccgtctgccatgccggtgacggcccgtaagacctggattgccggacaattgcag
cccgccggtattctgagcgtcgatgcgggtgccgaaacagcccttcgtgctggcaaaagc
ctattgcccgcaggcgtgcgtgaggtctccggccactttcatcgtggtgacacgatttcg
gttgttgggcttgagggacgggaaattgcccgaggcctggcgggttacgatgccgatgag
gcgcgaaggattgccgggcataaatcggcggagatcgaggcgctgctcggctatgccgga
cgctcggcgatgatccatcgggacgatctggtgatgacggaacagaccggcaggaaagcc
ggcaagagtacaaagaaaaaggacgaggcccatgcttga

DBGET integrated database retrieval system