KEGG   Agrobacterium vitis S4: Avi_5106Help
Entry
Avi_5106          CDS       T00851                                 

Definition
oxidoreductase
Orthology
K11178  
xanthine dehydrogenase YagS FAD-binding subunit [EC:1.17.1.4]
Organism
avi  Agrobacterium vitis S4
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:avi00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:92996..93946
Genome map
AA seq 316 aa AA seqDB search
MKAFTFERAPSIEAAVKTAAANPDARFIAGGTNLLDLMKLEIETPTHIIDVNGLGLDEIE
STDDGGLRIGALVRNTDLAAHMTVRRDYGLLSRALVAGASGQLRNKATTAGNLLQRTRCP
YFYDPNQPCNKRQPGSGCSAIGGFSRQHAVVGVSDACIATHPSDMAIAMRALDATIETVK
ADGSRRSIPIADFHRLPGETPHIESVLERGEFVTAVLLPPPIGGKHIYRKVRDRASYAFA
LISVGAVIQADGTGRVAVGGVAHKPWRIEAAEAELPRGARDAAKAILADARPTEQNRFKV
DLVERTLGAVLSEARG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttcacctttgagcgcgcgccctcgatcgaggccgcagtgaaaacggctgct
gccaacccagacgccaggtttatcgccggtggcaccaacctgctcgatctgatgaaactc
gagatcgaaacgccaactcatatcatcgatgtgaatggacttggtctcgatgaaatcgaa
tccaccgatgacggtggtctgcgcatcggtgctctcgtgcgaaataccgatcttgccgca
cacatgactgttcgccgcgactacggtctgttgtcgcgagccctggttgccggtgcctcc
ggccagcttcgcaataaggcgaccacggccggtaacctgttgcagcgcacccgctgtccg
tatttctatgatccgaaccagccgtgcaacaagcgtcagccgggcagcggctgctcggcc
attggtgggttcagccgtcaacatgcggttgtcggggtaagtgatgcctgcatcgccacc
catcccagcgatatggcaatcgccatgcgggcgctcgatgcgaccatcgaaacagtaaaa
gcagatggcagccgccggtctattccgattgccgatttccatcgtcttccgggagagacc
ccacatatcgaaagcgtattggagcgcggcgaattcgtgaccgctgttctgcttccacca
ccgatcggcggaaagcatatctatcgaaaggtccgggaccgggcgtcctatgcgtttgcg
ctgatttcagtcggcgctgtcattcaagcggatggtacggggcgtgttgccgtcggcggt
gtcgctcataagccctggcggatcgaagccgcagaagcggaactgccaagaggcgctcgc
gatgcggcgaaagccattctcgccgatgcccgtccgactgaacagaaccggttcaaggtc
gatcttgtcgagcgtacgcttggcgccgtcctttccgaagcaagggggtga

DBGET integrated database retrieval system