KEGG   Agrobacterium vitis S4: Avi_5115Help
Entry
Avi_5115          CDS       T00851                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
avi  Agrobacterium vitis S4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:avi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:avi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:avi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(102879..104240)
Genome map
AA seq 453 aa AA seqDB search
MTKQPKITFIGAGSTVFMKNIIGDVLQRPALSGARIALMDINPQRLEESEVVARKLISTF
GASATVETFADQRKALEGANFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWSICEDMMQVCPQAIMLQYVNPMAINTWAIAEKYPAIKQVGLCHSVQGTA
MELAEDLSIPYEDIRYRSAGINHMAFYLNFEHRQPDGSYRDLYPDLLRGYREGRAPKPTW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKDGREDLIEKFGIPLDEYPKRCIEQ
VERWKDQAAAYRSADKIEVKPSKEYASSIINSVWTGEPSVIYGNLRNNGCITSLPDNCAV
EVPCLVDDNGIQPTTIGALPPQLTALMRTNINVQELTVAALINENPEHLYHAAMMDPHTA
AELDLDQIWSLTTDLLKAHDQWIPQWARIGGVA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacagcccaaaatcaccttcattggtgccggttccaccgtgttcatgaagaat
atcatcggcgacgttctgcaacgtccggcactatcaggtgcgcgtatcgcactgatggat
atcaatccgcagcgtctggaagaaagcgaagttgttgccaggaagctgatttccaccttt
ggcgcatccgcaacggttgagacctttgccgatcagcgcaaagcgctggagggggccaac
ttcgtggtcgtcgccttccaaatcggcggttatgagccttgcaccgtcaccgatttcgag
gtgccaaagaaatacggcctgcgccagaccattgccgacacattgggcgttggcggcatc
atgcgcggtttgcgcaccgtgccgcatctgtggagcatttgcgaggatatgatgcaggtc
tgcccgcaagcgatcatgctgcaatatgtcaacccgatggccatcaatacctgggcgatt
gccgagaaatatccggccatcaaacaggttggcctgtgccactccgttcagggtacggcc
atggaactggcagaggatctgtccattccctatgaggacatccgctaccgctctgcaggc
atcaatcacatggcgttctacctcaatttcgagcaccgccagccggatggctcctatcgt
gacctctatcccgatctgctgcgcggctatcgtgagggccgcgcgccgaagccaacctgg
aacccgcgctgccccaacaaggtgcgctatgaaatgctgacgcgccttggctatttcgtc
accgaaagctcggagcattttgccgaatacacgccgtatttcatcaaggacggccgcgaa
gacctgattgagaaattcggtattccgctggatgaatatcccaagcgctgcatcgaacag
gttgagcgatggaaggatcaggccgctgcctaccgctccgcagacaagatcgaagtcaag
ccatcgaaggaatatgcctcgtcgatcatcaattcggtctggacgggtgagccctcggtg
atttacggcaacctgcgcaacaatggctgcatcacctcgctaccggacaattgcgccgtg
gaagtgccctgccttgtcgatgacaacggcattcagcccaccaccatcggcgccctgcca
ccgcagctcacagccctgatgcgcaccaacatcaacgtgcaggaactgacggtggctgcc
ttgatcaacgaaaaccccgaacacctctatcacgccgcgatgatggacccgcatacagca
gccgaactcgacctcgaccagatctggtcattgacgacggacctgttgaaggctcacgat
cagtggattccgcaatgggcccgcatcggaggggtggcgtaa

DBGET integrated database retrieval system