KEGG   Agrobacterium vitis: Avi_5121Help
Entry
Avi_5121          CDS       T00851                                 

Gene name
melA
Definition
alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
avi  Agrobacterium vitis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Avi_5121 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Avi_5121 (melA)
   00600 Sphingolipid metabolism
    Avi_5121 (melA)
Enzymes [BR:avi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Avi_5121 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(110353..111825)
Genome map
AA seq 490 aa AA seqDB search
MSSFKIAIIGAGSVGFTKKLFADLLSVPEFHDVEFALTDISQHNLDMIKTILDRIVEANR
LPAKVTASTDRRDAISGARYIISCVRVGGLGAYADDISIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIRELAEPGAKFLNYANPMAMNTWAAIEYGKVDTIGLCHGVQHGAEQ
IAEILGADPVELDYICSGINHQTWFVDVRVKGRKIGKQELIDAFEAHPVFSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPEEITRWIDMSDWIHGETGGYLRYSTETRNWFETE
FPQFLESAGKPHDPAKRSNEHASHILEALETGRVYRGHFNVKNNGIITNLPLDAIIESPG
FVDRFGINMVAGITLPEACAATCISSINVQRMSVHAAISGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAEWLPQYAHAIPEAKERLSRGTVKTRDWKGVARRDVRSIDELRAE
KEATKLKAAS
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcttcaagatcgccatcatcggggctggcagcgtcggctttaccaagaaactt
ttcgccgaccttttgagtgtgccggagtttcacgatgtggaatttgcgctcaccgatatc
agccagcacaatcttgatatgatcaagacaattctggatcgaattgtcgaggcaaacagg
cttcctgccaaggtgacggcatctacggatcgccgcgacgccatttcgggtgcgcgctat
attatcagctgcgtgcgcgtcggcggtcttggggcctatgccgatgatatcagtattccg
ctgaaatatggtgtcgatcaatgcgtgggcgatacgatttgcgcaggcggcattctctat
ggccagcgcaatattccggtcattctggatttctgcaaggatatccgtgaactggccgag
ccgggcgcgaaatttctcaactatgccaaccccatggcgatgaatacctgggcggcgatt
gaatatggcaaggtcgatacgattgggctttgccatggcgtgcagcacggtgcagagcag
attgccgagattttgggtgccgatccggttgagctggattacatttgctccggcattaat
caccagacatggtttgtcgatgtgcgcgtcaagggccgcaagattggcaagcaggagctg
atcgatgcctttgaggcccatccggtgttctcgcagcaggagaagctgcgtatcgatgtt
ttgaaacgcttcggggtctattcaaccgagagcaacggccatctgtcggaatatctgcct
tggtaccgcaagcggcctgaagagattacccgttggattgatatgtccgactggattcac
ggcgaaaccggtggttatctgcgctattccactgagacccgcaactggtttgaaaccgag
tttccgcagtttctggaaagtgcgggcaagccgcatgatccggccaagcgctccaatgaa
catgccagccatattctggaagcactggaaaccggacgggtctatcgcggccatttcaat
gtgaaaaacaatggcatcatcaccaatctgccgttggatgccattattgaatcgcccgga
tttgtcgatcggttcggtatcaacatggtagcgggtatcaccctgccggaagcctgtgcg
gccacctgcatttcctccatcaatgtccagcggatgtcagtgcatgcggctatttcgggg
gatatcgatcttctgaaactcgcagtgctgcatgatccgctggtgggggcgatctgcacg
ccggaagaagtctggcagatggtggatgagatggtggtggcccaggctgaatggctaccg
caatatgcccatgccattcctgaagccaaagaacggctgagccgaggtaccgtcaagacc
cgcgattggaagggcgttgcccggcgcgatgtgcgttccattgatgaattgagggccgaa
aaggaagcgacaaagctgaaggccgcaagctga

DBGET integrated database retrieval system