KEGG   Agrobacterium vitis: Avi_5230Help
Entry
Avi_5230          CDS       T00851                                 

Definition
L-fuculose-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
avi  Agrobacterium vitis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Avi_5230
Enzymes [BR:avi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Avi_5230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:231161..231814
Genome map
AA seq 217 aa AA seqDB search
MAKFMAQRQEIADMCRYFADNGYFAGTGGNIGVRVDKQLMAVTPSASDYYTVEAKDVVIL
DIETLDIVEGDKTPTIEKGLHARMLLMHPTRHASVHTHQPIASAVALLHEILPWPRGSDL
GALGPHVALIPYRPSGTGMLAKIFAKSLRPDIFAYLLASHGVICAGADLKTAAGMIRKIE
AAAAAHLRERINKHVNLDRQLQAFILNVLDKAETKGA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattcatggcccagcggcaggagattgccgatatgtgccgctatttcgcggat
aatggctattttgccggaaccggcggcaatatcggcgtccgcgtcgataagcaattgatg
gcggtcaccccctcggcctccgactattacacggtcgaggcgaaagacgtggtgatcctc
gatatcgagaccctcgacattgtcgagggcgacaagacgccgaccattgaaaagggactg
catgccaggatgctccttatgcatcctacccgccatgccagtgttcatacacaccagcct
atcgcaagcgctgtcgccctgctgcatgaaatcctgccctggccaaggggaagcgatctt
ggggcactgggtccccacgtcgcgcttattccctacaggccgtcaggcacgggaatgctg
gcaaagatttttgcgaagtccctgcggcccgacatctttgcatatcttctggccagtcac
ggcgtcatctgcgcgggggccgatctcaagaccgccgcgggcatgatccgcaagatcgaa
gccgccgccgccgcccacctgcgcgaacgcatcaacaaacacgtcaatctggatcggcaa
ctccaggcgttcattctgaacgttctggacaaggctgagaccaagggagcttga

DBGET integrated database retrieval system