KEGG   Agrobacterium vitis: Avi_5336Help
Entry
Avi_5336          CDS       T00851                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
avi  Agrobacterium vitis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avi_5336
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avi_5336
   00052 Galactose metabolism
    Avi_5336
   00500 Starch and sucrose metabolism
    Avi_5336
   00520 Amino sugar and nucleotide sugar metabolism
    Avi_5336
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Avi_5336
   00524 Butirosin and neomycin biosynthesis
    Avi_5336
Enzymes [BR:avi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Avi_5336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(337043..338479)
Genome map
AA seq 478 aa AA seqDB search
MSLPLFSIGIDVGGTNMRAAQISPKGEIIRKTSVTGSRDPSKAVTLIKSLIHEMDGERAT
AIGIGIPGRVDGWTGEIISGGFLNLSGCDLQSEMSATSGRPVTVANDCSMALIGEARVGA
ARGMNSSVMLTIGTGIGGAVMENGRIVNGRRCAGQLGHLVVNLHGQPCPCGQRGCIETES
SGTALQRHLREAGYAPETRFEAILALAESGDKVALQVMTAWAAPLKSAINTLSAAFDPDV
VLLGGGMGKAALAALNFLPRSETWYEADIRGARLDDDAGVIGCGLAAFDLLNADHPGKPA
HGKRLVMVNGVPASGKSAISHKIAGETGWQVLSLDEIKNPFLELIDDVDRPFNRLLGRAS
YKSIFSIIRDAAPGTTFIVDAWFGFQPADVLKEHIAMAGITQIVELWCHAPAETIGERYR
SRLENRLPGHPGASYIPELIELAQRAEPIGLAPVLNIDTTQPKDAKAILDWMVKAFEN
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttccattgttttctatcggcatcgacgtcggcggaaccaacatgcgtgcggca
cagatttcgccgaaaggcgaaatcatccgtaagacgtcggttacaggcagccgcgacccc
tccaaggctgtcactcttataaagagcctgatccacgagatggatggggagcgcgccacg
gcgattggaataggaatacccggccgtgtcgatggatggacaggagagatcatatcgggt
ggatttctgaatttatccggctgcgatctccagtctgagatgtcagcaacatcaggtcgt
ccggtgaccgttgcaaatgattgcagcatggccctgattggcgaggcccgcgtgggtgct
gcgcggggcatgaacagttctgtcatgctgaccatcggaaccgggattggcggcgccgtc
atggaaaatggccggatcgtcaatggcagacgatgcgctggccaattgggccatcttgtc
gtcaatctccatggccagccatgtccctgcggtcaacgcggctgtattgaaacggaatcc
tcaggaaccgccctgcaacgtcatctccgcgaggcaggctacgcacctgaaacacgattt
gaagccatcctggctctggcggaatcaggagataaggttgcattgcaggtgatgacagca
tgggccgcgcctctgaagtcagccatcaacacgctctccgccgccttcgacccggacgtg
gttctgctgggtggaggcatgggcaaggcagcgttagccgccctcaattttctgcctcgt
agcgagacctggtatgaagcggatatcaggggagcgcgcctcgatgacgatgccggtgtc
atcggttgcgggctggcggccttcgatctcctcaacgccgatcatcctggcaaacctgcc
catggcaagagactggtcatggtaaacggcgtacccgcctccggcaaaagcgcgatctcc
cataaaatcgccggtgaaaccggctggcaggtgttgagcctggatgagatcaaaaaccct
tttctggaattgattgacgatgtcgaccgccccttcaatcgcctcctgggacgcgcgagc
tataagtcgattttctccatcatccgcgatgccgcaccgggaaccaccttcatcgtcgat
gcctggtttggatttcagccagcagatgttctgaaagagcatatcgcgatggctggcatc
acacagatcgttgaactctggtgccacgccccagccgaaacgataggcgagcgctataga
tcaaggcttgaaaaccgccttcccggacatcccggcgcatcctatatcccggaacttatc
gaactcgcgcagcgtgcggaacccatcgggcttgctccggttttgaatatcgacacgaca
caaccaaaggacgccaaagccatcctggattggatggtgaaggcctttgaaaactaa

DBGET integrated database retrieval system