KEGG   Agrobacterium vitis: Avi_5372Help
Entry
Avi_5372          CDS       T00851                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
avi  Agrobacterium vitis
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Avi_5372
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Avi_5372
Enzymes [BR:avi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Avi_5372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2:complement(370659..372056)
Genome map
AA seq 465 aa AA seqDB search
MAGTSFLSDLLSGVTERGRALLFSGSKARDRVVDTDIETLCEMLLSSRGEASGMAIAAEI
LDRWSRFNAAEAVQFLHMLSDRFGAEAAALDKAIDAYRTDKSPMAVIALHNAAEPRRQEL
LRRLNLAPNGTQKLVRMRERLLETKEDRADLGAVDTDFAHLFSSWFNRGFLTLQPIDWTT
PAHILEKIIKYEAVHEIAGWEELRRRLAPADRRCFAFFHPRLRDDPLVFVEVALTRSIPS
AIADVLDESRDHIGADTATTAVFYSISNCQDGLRGISFGNFLIKQVVEDLRRDLPGLKEF
VTLSPVPGFARWISKIRDPKSGFPLSPEDRNTLVLLDDPTWPEDKARADAVERILLPLAA
RYFITERTPDNRPVDPVARFHLGNGARLERLNFLGDRSVKAMRQAHGLMVNYLYKLEDIE
TNHEALAQRGEVAASPAVKALQGKIEPILPEKPKDIKKAESLSGS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccggaacctcttttctcagtgacctgctttcgggcgtcaccgaacgcggtcgcgcg
ctgctgttttcgggatcgaaggcgcgcgacagggtcgtcgataccgacatcgaaaccctg
tgcgaaatgctgctttcaagtcgcggcgaagcctcgggcatggcaatcgcggcggaaatc
ctggatcgctggagccgtttcaatgccgcagaggccgtccagtttctgcacatgctgtct
gaccgtttcggcgcggaagccgcagcgctcgacaaggcgatagacgcctatcggaccgac
aaaagccccatggccgtcatcgcgctgcacaatgcagccgaaccgcgccggcaggaactt
ttgcgccgcctcaaccttgcgcccaacggcacgcaaaagcttgtccgcatgcgcgaacgc
ctgctggagaccaaggaggatcgcgccgatcttggcgctgtcgataccgatttcgcccat
cttttcagttcctggttcaaccgtggctttctgacgctgcaacccatcgactggacgaca
ccggcgcatatcctggaaaagatcatcaaatatgaggccgtacacgagattgccgggtgg
gaagaattgcgccggcggctcgcaccggcagatcggcgctgctttgcctttttccatccg
cgcctgcgggatgacccgctcgttttcgtggaagtcgcgctgacccgttcgataccgagc
gccatcgccgatgtgctggacgaaagccgggatcatatcggcgccgataccgcaacgact
gcggtcttctattcgatttccaactgccaggacgggcttcgcggcatttccttcggaaat
tttctcatcaagcaggtggtagaagacctgcggcgggatcttcccggcctcaaggaattc
gtcacgctctcgccagttccgggtttcgcccgctggatttcgaagatcagggacccgaaa
tctggtttcccactgtcaccagaagatcgcaatacgctggtcttgctggatgatccgaca
tggcctgaggataaggccagagcggacgcagtagagcggatcttgctgccgctcgcggcg
cgatattttatcacggagagaacgccggacaatcgtccggtggatcccgttgcccgtttc
caccttggcaatggcgccagactggagcggcttaactttctgggcgatcgttcggtaaag
gcaatgcgccaggcgcatgggctgatggtcaactacctctacaagctggaggatatcgag
accaatcacgaggccctcgcacagcgcggagaagtggcagcgtcgccagccgtcaaagct
ttgcagggaaagattgagcccatccttcccgaaaaacctaaggacattaaaaaagcagag
agcctgtccggttcgtaa

DBGET integrated database retrieval system