KEGG   Agrobacterium vitis: Avi_5529Help
Entry
Avi_5529          CDS       T00851                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
avi  Agrobacterium vitis
Brite
Enzymes [BR:avi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Avi_5529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:524525..525340
Genome map
AA seq 271 aa AA seqDB search
MSTDALSFYQEGSNGSGILLVHGLTGAPAEMRLVARQLHRRGYSVYAPLLAGHGKDEAAL
RKTRWQDWLESVEEAGQVLASRVDAAFAAGICAGGKLALMAADRQPLTLRAAAIYSPCFH
YDGWDIPRHYNFMARNIRWLAKIPFLDRLRFHETRSLGIKDDRLRNKIAAMSGDGVLESF
PGKGLVEMDKLGRVLKARLPSMQTPTLIVHSLEDDVSSPSHAQYISSHLGGPRELHWLRD
SYHMIHMDRQHRHVADLTADFFEAHYVPNRA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgatgcgctttccttttatcaggaaggaagcaatggcagcggcatcctcctt
gttcacggtctgacaggggcgcctgcggaaatgcggctggtcgcccggcaattgcaccgg
cgcggatattcggtctatgccccgctgctggcagggcatggaaaggacgaagcggctttg
cgcaagacgcgctggcaggattggcttgagagcgtcgaggaagccgggcaggttctggcc
tcacgggtcgacgcagccttcgccgctggtatctgcgccggtggaaagctggcgctgatg
gcggcggatcgccagccgctgaccctgcgtgcggcggccatctattcgccctgttttcat
tacgatggctgggacattccccgccattacaatttcatggcccgcaatatccgctggctg
gcgaagatccccttcctggaccggctaaggtttcacgaaacccgctcgctcggcatcaag
gacgaccggctgcgcaacaagattgccgccatgagtggcgacggcgtgttggagagcttc
cccggcaagggattggtggaaatggacaagcttgggcgggtgctgaaagcccggctgccg
tctatgcagaccccgacgctgatcgttcattcgcttgaggatgatgtcagcagcccaagc
catgcccaatatatctcgtcgcatcttggcgggccgcgcgaactgcattggctgcgggac
agctatcacatgatccatatggaccggcagcatcggcacgtcgccgatctgacagcggat
tttttcgaggctcattatgtaccgaaccgagcttaa

DBGET integrated database retrieval system