KEGG   Agrobacterium vitis S4: Avi_5563Help
Entry
Avi_5563          CDS       T00851                                 

Gene name
glgB
Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
avi  Agrobacterium vitis S4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:avi00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(568359..570566)
Genome map
AA seq 735 aa AA seqDB search
MTIATSDLLSGIDAQSVQALIDGRHGDPFSILGPHRTDEETVVRAIFPGALGVEMLDRNS
NAPVGRLNLVHPGGLFAGELRSSSRYRFRIEWQGAVQIAEDPYAFGLLLGDMDLHLIAEA
THYDLARTLGANPREMDGVPGVGFAVWAPTAQRVSVVGDFNSWDGRRNPMRLRQAGGIWE
LFVPGLGPGERYKYELIDAQGNVLPQKADPVAKASEAAPGTASIVASNTPFAWTDQAWMT
RQTADAAAREPISIYEVHLGSWLRISEDGNRWLDWVELSQRLVPYVKSMNFTHIELLPIT
EHPFGGSWGYQPLGLFSPTGRYGTPEDLAYFIDRCHASGVGVLLDWVPAHFPTDVWGLAR
FDGSALYEHEDPREGFHRDWNTLIYNLGRKEVKGFLIASAFEWLEHFHIDGLRVDAVASM
LYRDYSRNDGEWIPNQFGGRENLESVEFFKHLNSVVHSRCPHALMIAEESTAWPGVTKSP
EEGGLGFDFKWNMGWMHDSLSYIEEDPVYRRYHHGTMTFSMIYQYSERFVLPISHDEVVH
GKGSLLGKMPGDHWQKLANLRAYYGFMWAHPGKKLVFMGCEIGQDIEWNHDQSISWDLLD
RPDHAGIQTLVAKLNRLYQQEKALQFSDLDPAGFEWAIADDAENSVIAMLRYDENRETCI
LAISNFTPILRHDYRVGVPMQGRWIEILNSDASEFGGSGQGKGDVSAEPHPAHGREFSIN
LALPPLATLYLKWVA
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgacgattgccacgagcgacttgctatccggcatcgatgcccagtcggttcaagccctg
atcgacggcaggcacggcgatcccttttccattctgggaccgcatcggacagatgaggaa
acagtggtccgggcgatttttccgggtgcgctcggcgttgaaatgctcgacagaaacagc
aatgccccagtcggccggctgaacctggtgcatccgggcggcctgtttgccggagagctt
cgctcttcctcgcgctaccggtttcggatcgaatggcagggcgcagtgcagattgccgaa
gacccctatgccttcggcctgctgctgggcgatatggacctgcatctgatcgccgaggcc
actcattacgatctcgctcgcacgctgggcgccaacccgagagagatggacggggtgccc
ggggttggctttgccgtctgggcgccaactgcacagcgcgtttcggtggttggcgatttc
aattcctgggatgggcggcgcaacccgatgcgcctgcgccaagccggcggcatctgggaa
ttgttcgttccgggcctcggccccggcgagcggtacaaatatgaattgatcgacgcgcaa
ggcaatgtgctgccgcaaaaggccgatccggtcgccaaagccagcgaagcggcaccggga
acagcatccatcgtcgcgtcaaacacgccttttgcctggacggaccaggcctggatgaca
aggcagaccgccgatgctgccgcccgtgagccgatctcgatctatgaagtgcatctcggc
tcgtggctgcggatctcggaagatggcaatcgctggctcgactgggtggaactgagccag
cggctggtgccctacgtcaaatcgatgaatttcacccatatcgaattgctaccgatcacc
gaacatccgtttggcggctcctggggttatcagccgcttggcctgttttctcccaccggg
cgctatggcacgcccgaggatttggcctatttcatcgaccgctgccatgcgagcggtgtc
ggcgtgcttctcgactgggtacctgcccattttccaacagatgtctggggcctggcacgc
ttcgatggtagcgcgctttatgagcatgaagacccgcgcgagggctttcatcgggactgg
aacacgctgatctacaatctcggtcgcaaggaggtgaagggctttctgatcgccagcgcc
ttcgagtggctggagcatttccatatcgacggcctgcgggtcgatgccgttgcctcgatg
ctgtaccgcgactatagccgcaacgacggcgaatggattcccaatcaattcggcggacgg
gaaaacctcgaatccgtcgagttcttcaagcatttgaacagcgtcgtacacagccgttgc
ccgcatgcgctgatgattgccgaagagtcgaccgcctggccgggtgtgaccaaatcaccg
gaagaaggcggcctcggcttcgatttcaaatggaacatgggctggatgcacgacagcctg
tcctacatcgaagaagatccggtctatcgcagataccatcacggcacgatgaccttcagc
atgatctatcaatattcggagcggtttgtgctaccgatttcccatgatgaggtcgtgcat
ggcaaaggctcgttgctggggaaaatgcccggcgaccactggcagaaacttgccaatctc
agagcgtattatggtttcatgtgggcgcatcccggcaagaaactggtgttcatgggctgc
gagatcggccaggacatcgagtggaaccacgatcaatcaatatcctgggatttgctggac
cgaccggatcatgccggtatccagactttggtcgccaagctgaaccggctgtatcagcag
gaaaaggccctgcaattcagcgatctcgaccccgccggatttgaatgggcgattgccgac
gatgccgaaaattcggttatcgccatgttgcgctatgacgagaatcgtgagacctgcatt
ctggcgatctcgaatttcacaccgatcttgcgccatgactaccgtgtcggcgttcccatg
caaggacggtggatagaaatcctcaacagcgatgcaagtgaatttggtggctcagggcaa
ggaaagggtgacgtctcagccgagccgcatccggcccatggcagggaattttcgataaac
ctcgccctgccaccactggcgacactctatctgaaatgggtggcctag

DBGET integrated database retrieval system