KEGG   Agrobacterium vitis: Avi_5566Help
Entry
Avi_5566          CDS       T00851                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
avi  Agrobacterium vitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Avi_5566
Enzymes [BR:avi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Avi_5566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:577396..579210
Genome map
AA seq 604 aa AA seqDB search
MDPIMTSMINRLAKKHGINLARPGIEQAEVPISDVTKRRLLAALNVEAGEPGRSYLPDCL
ARDRVWGISLQLYELRSVRNWGIGDFADLQSMVMLAADQGADFIGLNPLHAPFLADPARC
SPYEPSNRRFLNPLYIAVDLVPGYHPGMSDRETLDALRRSKLVDYKAVAGVKLEVLRRIW
DGSRRLERNDDQDRADFRRFCDESGDALQNHGLFEALSRFMSEGGHGAGWMSWPGEYQDI
DHPSVRAFRSQNAEEIAFHVWLQWVAHRQLETVAAQARKAGLRIGLYLDLAVGEALDGSA
TWSEPDIYLRGASIGSPPDPWAVKGQDWRLAALQPALIAFSCRSPYRQMIDVAMRYAGAV
RIDHAAAIQRLFLVPADMGPEEGAYVDYPAREIQGVIAEASLRNQCLVIGEDLGLVPSGL
RQQMVDANLLSYRILSYERDKRGFIAPDKYPVMALACVSTHDHQTLVGWWRGADIEARAA
HGLVPEAARLQEQAARIQERADLLRAVALAGIELQEHGVEQPDLHERVVAAHRFMAKTAS
MLVSVRLADLTDEENPTNIPGTSSSYPNWQPKLSVACEDLTGFTLFNRIVDAVREERPKT
KEGS
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggacccaatcatgacgtcaatgatcaacagacttgccaagaaacatgggatcaacctc
gccagaccgggaatagaacaggcggaagttccgatttcagacgtcacaaaacgtcggttg
ttggcggctctcaacgtggaagcgggtgagcctggtcgcagctatctgcccgattgcctt
gctcgagatcgtgtctggggcatcagcctgcaactttatgaactgcgatcagtgcgcaat
tgggggattggcgactttgccgatttgcagagcatggtgatgcttgccgccgatcaaggt
gccgattttatcgggcttaacccgctgcacgcgccttttctggccgaccccgcccggtgc
agtccctatgagccatccaaccggcgctttctcaatccgctttatatcgctgtcgatctg
gtgccgggttatcatccaggcatgagcgacagagagacgctcgacgctttacggcgatcc
aaacttgtcgattacaaagcggtcgccggtgtgaagcttgaggttctgcggcggatctgg
gacggttcaagacggttggagcgaaacgacgatcaggacagagccgatttcaggcgtttc
tgcgatgaaagcggtgatgctctacaaaatcacggtctcttcgaggctttatcccgattc
atgagcgaaggtggccatggtgcaggctggatgtcctggcctggggagtatcaggatatc
gatcatccctccgttcgggccttccgtagccagaatgccgaggagatcgcatttcatgtg
tggcttcaatgggtcgcgcaccggcagctggagacggttgctgcccaagcgcgcaaagcg
ggcttgagaattggcctttacctcgacctcgcggtcggcgaagcgttggatggttcggcg
acctggagcgaaccggatatctatctgcgcggcgccagcatcggcagcccgcccgatcct
tgggcggtcaaaggccaggattggcggttggccgccttgcagccggcgttgatcgccttt
tcttgccgctcgccctatcgtcagatgatcgatgtcgcgatgcgctatgcgggtgcggtg
cgtatcgatcatgccgccgccattcagcgattgttcctggtgccagccgatatggggccg
gaggagggggcctatgtcgattatcccgcccgcgagatccagggcgtgattgctgaagcc
tccttgcgcaaccaatgcctggtcattggcgaggatctcggtctggtgccgtctggacta
agacagcagatggtggatgccaatctcctgtcctatcgcatcctgtcttatgaaagagac
aagcgcggctttattgcgccggacaaatatccggttatggcgcttgcctgcgtctcgacc
cacgatcaccaaacgttggtgggatggtggcgcggtgccgatatcgaagcacgcgcggcc
catggattggtgccggaagcggcaagactccaggagcaggccgcccgcattcaggaacga
gccgacctgctgcgagccgttgcgttggctgggatagagttgcaagaacatggtgtcgaa
cagccggatctgcatgagcgcgtcgtggcggctcatcggtttatggcgaaaacagcctcc
atgctggtctctgtccggcttgccgaccttaccgacgaggaaaacccgaccaatattccg
ggaaccagcagtagctatcccaattggcagccgaagctctcggtcgcctgtgaggatctc
accgggttcacccttttcaatcggatcgtcgacgccgtccgagaggaaagacccaaaaca
aaagagggtagctag

DBGET integrated database retrieval system