KEGG   Agrobacterium vitis S4: Avi_5740Help
Entry
Avi_5740          CDS       T00851                                 

Definition
Alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
avi  Agrobacterium vitis S4
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:avi00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:avi00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:avi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:765232..767337
Genome map
AA seq 701 aa AA seqDB search
MNDIVKIGADGLVLSLRMPEIGMPEIIGFGETPVADSALSEVERSSRINGMDEAVPSAVL
LPVGGMGFFGWPAISGHRSGRDFILQFADWTVEKTGRITLLCAQDAVAGMAITLRFETFP
SGVIGVSTDLKNIDGEDYILDRCMAASFLAPAGQVDVVSFTGMWGREFQTWRETLGTGLW
AQESRRGRTSHDRFPMLTIEGEGQSFGVTLGWSGNHQTVIDRLDDGRRLVHLGELFEPGE
TILAPGENYRSPVAYAGADRAAFHAFVRNDLMHWPDGAMSPRPVTLNTWEGNYFDHQMGS
LKAQATSAAELGIERFVLDDGWFGKRDDDTTSLGDWDIDARKYPDGLSPLVDHVTGLGMQ
FGIWFEPEMINPVSTLYELHPDWVLQVKGRPLLTSRNQLVLDLTRPEVSDYLFEKIDAVL
ANHAVSYVKWDMNRDLTHAGGRDGRAKISAQTRAVYALMDRVRAAHPQVEIESCASGGGR
IDYGALARTHRVWTSDCTDALERLEIQRGASVFVPPEVLGSHISASPNHQTERRHTLAFR
ALVALAYHLGVELNPLELEGEERAELKTWIAIHKRLRPLLHAPSANFSKEPRDGRYVWGA
ADSKRIAVFVAQGPQMGGEQPEPLTLPDGVTRIGGRWKIAATHPAQPNFIRISEGQKRLL
AGKVTFELADLKLGGLPLPMLRPESAILLELEPVEGGDHHG
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattgtaaagattggcgcggacgggctcgtcttgagcctgcggatgccagag
atcggcatgccggaaatcatcggctttggtgagacgcctgttgctgactcggctttgtcc
gaggtcgaacgctccagccgtatcaacggcatggatgaggccgtgccttcggcggtgctg
ctgccggtgggtggcatgggctttttcggctggcctgccatttcagggcatcgatccggc
cgcgacttcatcctgcaatttgccgattggacggtggaaaagaccgggcggatcacgctg
ctttgcgctcaggatgccgtggcgggcatggcgatcacgctgcgtttcgagacttttccg
tcgggcgtgatcggtgtctccaccgatcttaagaatatcgacggtgaggattacatcctg
gaccgctgcatggcagcgagcttccttgctcctgctggacaggtcgatgtggtcagcttt
accggcatgtggggccgtgaattccagacctggcgtgagacgttgggaaccggcctctgg
gcacaggaaagccgccggggccgcacctcccatgaccggtttccgatgctgacaatcgaa
ggcgaggggcagagcttcggtgtaacgctgggctggagcggcaaccaccagaccgtcatc
gaccggctggacgatggccgtcgcctcgtgcatctcggcgaactgtttgagccgggcgag
acgatccttgcgccgggcgagaactatcgcagcccggttgcctatgccggtgcggaccgg
gcggcgttccatgcctttgttcgcaatgacctgatgcattggcctgatggtgcgatgtcg
ccgcgtccggtgacattgaatacctgggagggcaattatttcgaccaccagatgggatcg
ctcaaggcgcaggcgacctccgctgccgaacttggcattgagcgtttcgttctggatgac
ggctggtttggcaagcgggatgacgacacgaccagccttggcgattgggatatcgatgcc
cgcaaatatcccgacggcctgtcgccgctggtcgatcacgtcaccggccttggcatgcag
ttcggcatctggttcgagccggaaatgatcaacccggtctccaccctctatgaactgcat
cccgactgggtcttgcaggtcaaggggcgcccgcttcttacatcgcgcaaccagctggtg
ctggatctgacacgaccggaggtcagcgactatctatttgagaagatcgacgcggtgctg
gccaatcatgctgtctcctatgtcaaatgggacatgaaccgcgacctgacccatgcaggt
gggcgcgatgggcgggcgaaaatttcagcccagacccgcgccgtctacgcattgatggac
cgggtgcgggcagcccatccgcaggtggagatcgaaagctgtgcgtccggcggtggccgg
attgattatggtgcgcttgcccgcacccaccgggtctggacctccgattgcactgatgcg
ctggagcggctggaaattcagcgcggcgcctcggttttcgtgccaccggaagtgcttggc
agccatatttcggcctcgccaaaccaccagacggagcgccgccatacgctggccttccgg
gcgctggtggcactggcctatcaccttggcgtcgagttgaacccgctggaactggaaggc
gaggaacgcgctgagctgaagacctggattgccatccacaagcggctgcggcctttgctg
catgcgccaagcgccaatttttccaaggagccgcgcgatgggcgctatgtctggggtgcg
gcggacagcaagcgcatcgccgtcttcgttgctcaaggcccgcagatggggggcgaacag
cctgagccgctgaccctgcctgatggtgtgacccgcatcggcggacgttggaaaattgcc
gccacgcatccggctcagccgaatttcattcgtatatccgaagggcagaagcgcctgttg
gctggcaaggtcacgtttgagcttgcagatctcaagcttggcggcttgccgctgccgatg
ctgcggccggaaagcgcaatcctgctggaactggaacctgttgagggaggagaccaccat
ggctga

DBGET integrated database retrieval system