KEGG   Agrobacterium vitis: Avi_5742Help
Entry
Avi_5742          CDS       T00851                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
avi  Agrobacterium vitis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Avi_5742
Enzymes [BR:avi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Avi_5742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:768427..770355
Genome map
AA seq 642 aa AA seqDB search
MLGVCYYPEHWPESQWHIDAQNMRKLGISYVRIGEFAWSRLEARRGQFTFEWLDRAIDIL
HEAGLKVVLGTPTATPPKWLMDEHPDIAPYDADGNVRGFGSRRHYSFSSEIWWAESARIV
EVIAKRYGTHPGIAGWQTDNEYGCHDTTVSWGPEDLKAFRRWLRMRYQTTDQLNEAWGSV
FWSMEVNSFDEVELPTRTVTEPNPAQRLDFWRFSSDQVAAYDKMQVDIIRKHSPGRWITH
NFMGFINDFDHFQVGDNLDLASWDSYPIGFVEKFPFTEDERNRWAETSHPDIAPFHHDLY
RGVGRGRFWVMEQQPGPVNWAPWNPVPKPGMVRLWTWEALAHGAEVVSYFRWRQAPFAQE
QMHAGLNLPGLDEWSVGGLEAHAVAGELAALGDLPESVQAPVALVYDYASYWATTIQPQG
RDFRYEELAFRWYEAARRLGLDVDFVRPGADLSGYKLVLVPCLMQVNEAALAAFKNTDAV
VLYGPRTGSRDEKFRIPENLPPGPLAPLTDTRQTQVASLRPRLGDSVSGSVSGRAIRWRE
YLETTATVIATFENGDPALTSQNDHHYLACWPDEALLSSTLAVLAEKAGLETLVLPEHIR
IRRRGNLTFAFNYGAEDWTIPVSGEFVLGGQVLKPQQLAVWV
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcgtttgctattatcccgaacattggccggagagccaatggcatatcgatgcg
caaaacatgcgcaagcttggcatttcctatgtgcgcatcggcgaattcgcctggtcgcgg
ctggaggcgaggcggggtcagttcaccttcgaatggctggaccgggccatcgatattctg
catgaggcgggcctgaaggtggtgcttggcaccccgaccgccacaccgccgaaatggctg
atggacgagcatcccgacattgcgccctatgatgccgacgggaatgtgcgcggcttcggc
tcgcgtcgccattatagtttttcgagcgaaatctggtgggccgaaagcgctcgaatcgtt
gaagtcatcgccaagcgctacggcacccatccgggcattgctggctggcagaccgataac
gaatacggctgccatgacaccaccgtatcttgggggcctgaagacctgaaggccttccgc
cgctggttgcggatgcggtatcagaccaccgaccagctcaatgaggcctggggctcggtg
ttctggtcgatggaggtcaacagttttgatgaggtcgagctacccacccgcaccgtgacc
gagccgaacccggcgcagcggctggatttctggcgcttctcctccgatcaggtggccgcc
tatgataaaatgcaggtggacatcatccgcaagcattcaccgggccgctggattacccat
aacttcatgggtttcatcaatgatttcgatcatttccaggtgggcgacaatctcgatctc
gccagctgggatagctatccgatcggcttcgtcgaaaaattcccgtttaccgaagacgag
cgcaatcgttgggcggaaacctcccatcccgacatcgcgcccttccaccatgatctctac
cgcggtgttggccgtggccggttctgggtgatggagcagcagcccggtccggtcaattgg
gcaccgtggaacccggttcccaagcccggcatggtcaggctgtggacctgggaagcgctg
gcgcatggggcagaggtggtcagctatttccgctggcgccaggcaccgtttgcgcaggag
cagatgcatgcaggcctcaatctgccggggcttgatgaatggtcggtgggcgggttggaa
gcgcatgccgttgctggcgaactggcagcgcttggcgatctgccagagagcgttcaggca
cccgtggcgctggtctatgactatgccagctattgggcgacaaccatccagccgcagggc
cgggatttccgctacgaggaattggcgtttcgctggtacgaagcagcccgccgcctgggg
ctggacgtggattttgtgcgccccggtgctgatctgtccggttataaactggtgctcgtt
ccctgcctgatgcaggtgaacgaggcggcgcttgcggcctttaaaaacaccgatgccgtc
gtgctgtacggtccgcgcaccggttcacgcgacgagaaattccgtattccggaaaacctg
ccgcccggtccgctggctcctttgaccgatacgcgccaaacgcaagtcgcctcactgcgg
ccccgtcttggtgatagcgtttcaggctcagtttcgggccgggccatccgctggcgggaa
tatctggaaaccacggcaaccgtcatcgccacattcgaaaacggcgatccggccctgacg
agccagaacgaccaccattatctggcctgctggcccgacgaggctttgctgtcttcaacg
ctggcggtgctggcggaaaaggctggtctcgaaacccttgttttaccagagcatatccgc
atccgccgccgtggcaacctcacattcgccttcaattatggggctgaggactggaccatt
ccggtatccggcgagtttgtcttaggcggacaagtgcttaagccgcagcaattggcggta
tgggtttga

DBGET integrated database retrieval system