KEGG   Agrobacterium vitis: Avi_6012Help
Entry
Avi_6012          CDS       T00851                                 

Definition
endoglucanase precursor
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
avi  Agrobacterium vitis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Avi_6012
Enzymes [BR:avi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Avi_6012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1015119..1016210
Genome map
AA seq 363 aa AA seqDB search
MAVMTTDRCESVLKRTITMSVALTLSVAPVISGQAWAGQACMRGVNLSGAEFGEIGGAPD
RAYTYPSAKTIGYFAEKGFNSVRLPFKWERLQPKLNSAFDADELKRLDTAVAQLKEAHLR
VVLDPHNFAVYHQKQINGPDVPVEAFADLWMRLAAHYANDQTIVFGLMNEPYDMPASQWL
PAANAAIAAIRQVGAKNLILVPGVSWTGAHSWQSDGYGGANGEVMLGVKDPGNNYAYEVH
QYFDADFSGTKDECSRAGDAVAAIETFTDWLRKNDKRGYLGEFGAPGGESCVKGIKDMVE
VVEKNPDRWVGWAYWVAGDWWPETEMLNIQPGKSGDRPQLAGLTPYLRDFSAASADCPSL
RSR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgacgacagacagatgtgagagcgtgttgaaaaggaccataaccatgtct
gtggctctcacgctttcggtggcaccggtcatcagcggacaagcgtgggccggtcaggcc
tgcatgcgaggggtcaatctttctggcgcggaattcggtgagattggcggcgccccggac
agggcctatacctatcccagtgccaagaccattggctattttgccgagaaaggcttcaat
tctgtaaggcttcccttcaagtgggaacgcctgcaacccaaactcaacagtgctttcgac
gctgacgagctgaaacgactggatacagccgttgcacagctgaaggaggcgcatctgcgg
gtggtgctcgatccgcataatttcgcggtctatcatcaaaaacagattaatggcccggac
gtgccagtggaggccttcgcggatttgtggatgcggctggccgctcactatgccaatgac
cagaccatcgtcttcggcttgatgaatgagccgtatgacatgccagccagccaatggctc
ccggctgcgaatgccgccattgccgccattcgtcaagttggcgcgaaaaaccttattctc
gtgccgggcgtgtcctggacaggtgcccatagctggcaaagcgatggctatgggggcgcc
aatggcgaggtgatgctgggggtgaaggaccccggcaataattatgcctatgaggttcac
cagtatttcgacgcggatttttccggcaccaaggatgaatgcagccgggcaggcgacgcg
gtggccgccatagagaccttcacggattggctgcgcaagaatgacaagcgtggctatctc
ggcgaattcggtgcgccgggcggagaatcatgcgtcaagggcatcaaggacatggttgaa
gtggtcgagaagaacccggatcgctgggtcggttgggcctattgggtggccggtgactgg
tggccggaaaccgaaatgctcaacatccagcccggcaagtccggtgacaggccgcaactg
gctggtctgaccccttatttgcgcgatttctcggcggcctcggcggattgcccatccttg
cggtcccggtag

DBGET integrated database retrieval system