KEGG   Agrobacterium vitis: Avi_6235Help
Entry
Avi_6235          CDS       T00851                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
avi  Agrobacterium vitis
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Avi_6235 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Avi_6235 (glmS)
Enzymes [BR:avi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Avi_6235 (glmS)
Peptidases [BR:avi01002]
 Cysteine Peptidases
  Family C44
   Avi_6235 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1228629..1229651)
Genome map
AA seq 340 aa AA seqDB search
MTTTMRQEINEIPQAVSRLLSDSRESLEQAGAALRKRDPAVLVTIARGSSDHAAHFLKYA
VELELGIVVASLGPSLASIYQAPLKLDRAAALAISQSGASPDLVALAKSAVAGGATTISL
LNTISSPLAAASDIAIDIQAGPEIAVAATKSFVNSIVAGLSLISAWSDNARLAAAVEALP
THLEKALALDWSGLVEVLKDADSLYMLGRGPTLAIACEAALKCKETSELHAEAYSSAEVL
HGPVSLVSANFPIIAFAARDKAEASIAATANGLAAKNASVFLTSSLAKEANHLSFIETGH
PLTDALALIVPYYGMVESLSRARGLDPDKPAALKKVTETR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgactatgcgccaggaaataaacgagattccgcaagcggtcagtagactgcta
agcgatagccgggagagtttggaacaagcgggtgcagcactccgcaagcgcgatcctgcg
gtgctggtcactattgcgcgtggttcttcagaccacgccgcccatttcctgaaatatgcc
gtcgaactggaactcgggatcgtcgtcgcctcgctcggcccgtctctcgcctcgatttat
caggcaccgctgaaactggatcgagcggcggcacttgcaatctcgcaatccggggccagc
ccggacctcgtggcgctcgccaaatccgccgtagccggtggggcaacgacaatttcgctg
ctcaataccatttcttcgccgctggccgcagcctctgatatcgccatcgacattcaagcc
ggaccggaaattgcagttgcggcgacaaaatccttcgtcaattccattgtcgctggcctg
tccttgatcagtgcctggagcgacaacgcacgcctggcagccgcagtcgaagccctgccc
acccatcttgaaaaagcgctggctctggattggagtggattggtggaggtgctgaaagat
gccgattcgctctacatgctcgggcgtggcccgacactggcgattgcctgcgaagcggcg
ctgaaatgcaaggaaacatctgagctgcatgcggaggcctattcttcggctgaagtgttg
catggtccggtctccctggtgtctgcgaatttcccgatcatcgcctttgccgcccgcgac
aaggcggaggcttctatcgccgcgacggccaatggacttgccgccaagaatgcgtctgtt
ttcctgacatcgtctttggcaaaggaggccaaccatttgtccttcatcgaaaccggccat
ccgctgaccgatgcgctggcattgattgtaccctattatggcatggtggaatcactatcg
cgcgcccgtggccttgatccggacaagccagccgctctgaagaaagtaacggaaacccga
tga

DBGET integrated database retrieval system