KEGG   Agrobacterium vitis S4: Avi_6235Help
Entry
Avi_6235          CDS       T00851                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
avi  Agrobacterium vitis S4
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:avi00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:avi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1228629..1229651)
Genome map
AA seq 340 aa AA seqDB search
MTTTMRQEINEIPQAVSRLLSDSRESLEQAGAALRKRDPAVLVTIARGSSDHAAHFLKYA
VELELGIVVASLGPSLASIYQAPLKLDRAAALAISQSGASPDLVALAKSAVAGGATTISL
LNTISSPLAAASDIAIDIQAGPEIAVAATKSFVNSIVAGLSLISAWSDNARLAAAVEALP
THLEKALALDWSGLVEVLKDADSLYMLGRGPTLAIACEAALKCKETSELHAEAYSSAEVL
HGPVSLVSANFPIIAFAARDKAEASIAATANGLAAKNASVFLTSSLAKEANHLSFIETGH
PLTDALALIVPYYGMVESLSRARGLDPDKPAALKKVTETR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgactatgcgccaggaaataaacgagattccgcaagcggtcagtagactgcta
agcgatagccgggagagtttggaacaagcgggtgcagcactccgcaagcgcgatcctgcg
gtgctggtcactattgcgcgtggttcttcagaccacgccgcccatttcctgaaatatgcc
gtcgaactggaactcgggatcgtcgtcgcctcgctcggcccgtctctcgcctcgatttat
caggcaccgctgaaactggatcgagcggcggcacttgcaatctcgcaatccggggccagc
ccggacctcgtggcgctcgccaaatccgccgtagccggtggggcaacgacaatttcgctg
ctcaataccatttcttcgccgctggccgcagcctctgatatcgccatcgacattcaagcc
ggaccggaaattgcagttgcggcgacaaaatccttcgtcaattccattgtcgctggcctg
tccttgatcagtgcctggagcgacaacgcacgcctggcagccgcagtcgaagccctgccc
acccatcttgaaaaagcgctggctctggattggagtggattggtggaggtgctgaaagat
gccgattcgctctacatgctcgggcgtggcccgacactggcgattgcctgcgaagcggcg
ctgaaatgcaaggaaacatctgagctgcatgcggaggcctattcttcggctgaagtgttg
catggtccggtctccctggtgtctgcgaatttcccgatcatcgcctttgccgcccgcgac
aaggcggaggcttctatcgccgcgacggccaatggacttgccgccaagaatgcgtctgtt
ttcctgacatcgtctttggcaaaggaggccaaccatttgtccttcatcgaaaccggccat
ccgctgaccgatgcgctggcattgattgtaccctattatggcatggtggaatcactatcg
cgcgcccgtggccttgatccggacaagccagccgctctgaagaaagtaacggaaacccga
tga

DBGET integrated database retrieval system