KEGG   Agrobacterium vitis S4: Avi_6251Help
Entry
Avi_6251          CDS       T00851                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
avi  Agrobacterium vitis S4
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:avi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:avi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1241649..1243568
Genome map
AA seq 639 aa AA seqDB search
MTEVAFRLDNAWYPIEGDDGGGFVFTLYNLSSEPVSGFKLAYTALTRVKDDPVCDNAVFL
RRNANFHQFAPPEGLVLAPGGCWRFTVQGLWRPARHRTDGAKSAYLTLADGRHVVVSVDD
LMLQGRVSAPAPVLLPKGEVSKPFSLLPWPVEANLAAGDGFPVAIYPAKGTDLSGLQAIE
RVNALYRRLFTVGHVPFSLAPVDQGKALKLAHDPALGASAYWLDFAEEITLSFGDEAGRQ
YGLTALAQMLHGARQDPAQFRFPVSGQIKDAPRYGWRGCHLDVSRQFYPTQDVLRLIDIM
AWMKLNIFHWHLTDDEAWRLEIKAYPQLTTVGVLRGPDEPMLPQLGNGAEPVGGFYTQED
VGHIVAHAALLHVEVVPEIDIPGHSTAILTALPELVDGQEAPDSYRSVQGYPNNALNPAI
EQTYVFLGKVLDEMATLFPSDLVHVGGDEVAANTWMASPLAKKLMEQEGIDGTFGLQSHF
MKRIQQMLKDRGKKLAGWDEVSHGGGVDPQGTLLMAWQKPEVGLDLARQGYDVVMTPGQA
YYLDMVQDEAWQEPGASWAGTVPPHHTYTYEAVAEFPEELKPRMRGVQACIWSEHFLNRD
YFNHLVFPRLPAVAEAAWTPRHQKEWLRFAALAPLMPRF
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtcgcttttcgtctggacaatgcttggtatcctatcgagggcgatgacggc
ggtggtttcgtcttcaccctctacaacttatcgtccgagcctgtcagcggtttcaagctt
gcctatacggccttgacgcgggtgaaggacgacccggtctgcgacaacgcagttttcctg
cgacgcaacgccaattttcaccagtttgcaccaccggaaggcctggttttggcgccagga
gggtgctggcggtttacggttcagggcctctggcggcccgctcgacatcgcacggatggt
gcgaaatcagcttatttgactcttgccgatggacgtcatgtcgtcgtctccgtcgatgat
ctgatgctgcaaggccgggtgagcgcccccgcgccagttctgttgccgaagggagaggtt
agcaagcctttttcgctgctgccgtggcccgtcgaggcgaaccttgcggcgggcgatggc
tttccggtggcgatctatcccgccaagggtacggatctttccggcttacaggcgattgag
cgggtcaatgcactttaccggcggctatttacagtcggccatgtgccattttcgctggcg
ccggtcgatcagggcaaagccttgaaactcgcccatgatccagcactcggcgcatctgcc
tattggctcgattttgctgaggagattacgctgtcctttggggatgaggcgggacggcaa
tatggactgacagcattggcgcaaatgctgcatggcgcaagacaagatcccgcgcagttc
aggtttccggtctccggccagatcaaggatgcgccgcgttatggctggcgcggctgccat
ctggatgtgtcccggcaattttatccgacgcaggacgtgctgcggctgatcgatatcatg
gcctggatgaagctgaatattttccactggcatctgaccgatgacgaagcttggcggttg
gaaatcaaggcctatccgcaactcacgactgttggcgtgctgcgtggcccggatgaaccg
atgttgccgcagcttggcaatggcgcggagccggtcggtggtttttacacccaggaggat
gttggccacatcgtcgcccatgccgccttgctgcatgttgaggtcgtgcctgagatcgat
attccgggtcatagcaccgcgatcttgacggccttgcctgaactggtcgatggccaggaa
gcgcctgacagctaccgctccgtccaaggctatccgaataacgcgctcaaccctgccatt
gagcagacctatgtgtttctcggcaaggttttggatgagatggcgacgctgtttccctcc
gatctcgtgcatgtcggtggtgatgaggttgcggccaatacctggatggcctcgccattg
gcaaaaaagctgatggagcaggagggcattgacggcacattcgggctgcaaagccatttc
atgaagcgcattcagcagatgttgaaagaccgcggcaagaaactggctggttgggacgaa
gtatcccacggcggcggtgtcgatccgcagggaacgctgctgatggcctggcagaagccg
gaggtaggactggatctggcgcggcagggctatgacgtggtgatgacgcccggacaggcc
tattatctcgacatggtgcaggacgaggcgtggcaggagccgggcgccagctgggccggc
accgtgccgccgcaccatacctatacctatgaagccgtcgcggaatttcctgaggaatta
aagcctaggatgcggggtgtgcaggcctgtatctggtcggagcatttcctgaaccgggat
tacttcaaccacctggtctttccgcgcctgccggctgttgccgaggccgcctggacccct
aggcatcagaaggagtggctgcgctttgcagctctcgcgccgctgatgccacgtttttaa

DBGET integrated database retrieval system