KEGG   Agrobacterium vitis: Avi_9223Help
Entry
Avi_9223          CDS       T00851                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
avi  Agrobacterium vitis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:avi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Avi_9223 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avi_9223 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    Avi_9223 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Avi_9223 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Avi_9223 (adhP)
   00626 Naphthalene degradation
    Avi_9223 (adhP)
Enzymes [BR:avi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Avi_9223 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pAtS4c:176968..178011
Genome map
AA seq 347 aa AA seqDB search
MKENSMEKTMKAAVVREFGKPLVIEEVTVPRPGAGQILVKIAATGVCHTDLHAAEGDWPV
KPKPPFIPGHEGVGHVVAVGSGVCHVKEGDRVGVPWLYTACGHCKHCLGGWETLCEEQQN
TGYSVNGSFAEYVVADPNYVGHLPDNVSFVDIAPILCAGVTVYKGLKVTDTKPGDWVVIS
GIGGLGHLAVQYAKAMGLNVIAVDIDDAKLDLAKRLGASLAVNARKDDPAAFVKKEVGGA
QGVLVTAVSPKAFEQSLGMVGRGGTVSLNGLPPGDFPLSIFDTVLNGVTVRGSIVGTRLD
LQEALDFAGEGKVKATIATERLENINDIFSRMHHGDIQGRIVIDFEK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ctgaaggagaattccatggaaaagaccatgaaagcggccgtcgtccgcgagttcggcaag
ccacttgttatcgaggaggtgaccgtaccccggccgggcgccggccagattctggtcaag
atcgccgccaccggggtctgccacaccgatctgcatgccgccgagggcgactggccggtc
aagccgaaaccgcccttcatccccgggcatgaaggtgtcggccatgtcgtggcggttggc
tccggcgtctgccacgtcaaggaaggcgaccgggtaggcgtgccgtggctctataccgcc
tgtggtcattgcaagcattgcctcggcggctgggaaacgttgtgcgaggaacaacagaac
accggctattcggtcaacggcagctttgctgaatatgtcgttgcggatcccaactatgtc
ggccacttgccagataatgtgtccttcgtcgatatcgcacccatcctttgcgccggggtg
accgtttataagggcctcaaggtgacggataccaagcctggcgactgggtcgtcatctca
ggcatcggtggtcttgggcatttggccgtacaatatgccaaggccatggggctcaatgtc
atcgcggtcgatatcgacgatgccaagctcgaccttgcaaaacggcttggtgcatcgctt
gctgttaacgcaaggaaagacgatccggcagccttcgtgaagaaagaagtcggcggtgcc
cagggcgttctcgtaaccgcggtttccccaaaagccttcgagcagtcacttggcatggtc
ggtcgtggcgggactgtatcgttgaacggtctgccgccgggagacttcccgctgtcgatc
ttcgacacggtgttgaacggcgtgacggtccgcggttccattgtcggcacgcggctcgac
ctccaggaagcgctcgacttcgccggagaaggcaaggtcaaggcaaccattgcgactgaa
cggctcgagaacatcaacgacatcttctcgcggatgcatcatggtgacattcagggccgg
atcgtcatcgacttcgagaagtag

DBGET integrated database retrieval system