KEGG   Azotobacter vinelandii CA: AvCA_08700Help
Entry
AvCA_08700        CDS       T02633                                 

Gene name
xylQ
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
avl  Azotobacter vinelandii CA
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:avl00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:avl00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:avl00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:avl00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:avl00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825562..826518
Genome map
AA seq 318 aa AA seqDB search
MDRTSSRCKVAIIGSGNIGTDLMIKVLRHGRHLEMGAMVGIDPASDGLARAKRLGVATTA
QGVEGLLALPEFKDIGIAFDATSAGAHARHNELLQAHGVKVIDLTPAAIGPYVVPAINLD
AELDAPNINMVTCGGQATIPMVAAVSRVAQVHYAEIVASIASKSAGPGTRANIDEFTETT
SKAIEVIGGARKGKAIIVLNPAEPPLIMRDSVFVLSEVVDRDAIAASVKEMVASVQRYVP
GYRLKQEVQFELIEKPANVPGVGLVSGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAALSC
AERLAERGKVRTLPSALV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtggatagaacatcgtcccgttgcaaggttgcgatcatcggttcgggcaacatcggaacc
gacctcatgatcaaggtgctgcgccatggcaggcacctggaaatgggcgccatggtcggt
atcgacccggcgtccgacggtctggcgcgcgccaagcggctcggcgtcgcgaccactgcg
caaggcgtggaagggctgctggcgctgccggagttcaaggacatcggcatcgccttcgac
gccacctcggccggtgcccacgcccgccacaacgagctgctgcaggcccacggcgtgaag
gtcatcgacctgaccccggcggccatcggcccctacgtggtcccggcgatcaacctggac
gccgaactcgacgcgccgaacatcaacatggtcacctgcggcggccaggccaccatcccg
atggtcgccgcggtgtcccgcgtggcgcaggtccactacgccgagatcgtcgcctcgatc
gccagcaagtcggccggccccggcacccgcgccaacatcgacgagttcaccgaaaccacc
tcgaaggccatcgaggtgatcggcggggcgcgcaagggcaaggcgatcatcgtcctcaac
ccggccgagccgccgctgatcatgcgcgacagcgtgttcgtgctctccgaggtggtcgac
cgggatgccatcgccgccagcgtcaaggagatggtggccagcgtgcagcgctacgtgccg
ggctaccggctcaagcaggaagtgcagttcgaactgatcgagaagccggccaacgtgccc
ggcgtgggtctggtgtcgggcctcaagacctcgatcttcctggaggtggagggtgccgcc
cattacctgccggcctatgcggggaacctcgacatcatgacctcggcggcgctgtcctgc
gccgagcggctggccgaacgaggcaaggtacgcaccctgccttcggcgctggtttga

DBGET integrated database retrieval system