KEGG   Azotobacter vinelandii CA: AvCA_27760Help
Entry
AvCA_27760        CDS       T02633                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
avl  Azotobacter vinelandii CA
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:avl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    AvCA_27760 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AvCA_27760 (rfbC2)
Enzymes [BR:avl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     AvCA_27760 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2858229..2858789)
Genome map
AA seq 186 aa AA seqDB search
MNRFTVTDLPLAGLKLVERRRFGDSRGFLARLFCAEELAATGWLQPIAQINHTFTTWRGT
VRGMHFQRPPHAEAKLVTCLQGEVWDVAVDLRAGSPTFLHWHAERLSADNARALLIPEGF
AHGFQTLTNGAALLYCHSAAYAPGAEGGLHPQDERLGIAWPLEIRELSVRDAMHPMVEGA
FEGVAL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtttcacagttactgacttgccgctggccggattgaaactggtggagcgtcga
cgcttcggggatagccgcggttttctggcccgtctgttctgcgcggaggagttggctgct
accggctggctacagcccatcgctcagatcaatcacaccttcacgacctggcgcggcacg
gtgcgaggcatgcactttcagcgtccacctcatgccgaggcaaagttggtgacctgcctg
cagggagaggtttgggatgtagcggtggatttgcgcgccggctcgcccacctttttgcat
tggcacgccgagcggctttcggcggataacgctcgggcgctgcttattcccgaaggtttt
gcccatggcttccagacgctgaccaatggggcggcgttgctgtattgccattcagcggcc
tatgcgcctggcgccgagggagggctgcatccgcaagatgagcgcttgggcatcgcctgg
cctttggagatcagagaactgtcggtacgagatgcgatgcatccgatggtcgagggtgca
tttgaaggagtagcactttga

DBGET integrated database retrieval system