KEGG   Azotobacter vinelandii CA: AvCA_28000Help
Entry
AvCA_28000        CDS       T02633                                 

Gene name
treS
Definition
trehalose synthase, maltokinase fusion protein
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
avl  Azotobacter vinelandii CA
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:avl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2883326..2886652)
Genome map
AA seq 1108 aa AA seqDB search
MDQSLKSVAFLEDPFWYKDAVIYQVHVKSFFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHPDYGSLADVRRLIAEAHRRGLRLITELVINHTSDQHP
WFQRARQARKGSAARNFYVWSDSDDKYRDTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLGIMRYWLDLGVDGLRLDAIPYLIERDGTNNENLPETHQVLKRIRA
ELDARYPDRMLLAEANQWPEDTQLYFGGAPEGKGDECHMAFHFPLMPRMYMAIAQEDRFP
MTDILRQTPDIPSDCQWAIFLRNHDELTLEMVTDRERDYLWNFYAADRRARINLGIRRRL
APLLERDRRRIELLNSLLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSTDRNGG
FSRADPAGLVLPPIMDPLYGFQSVNVEAQQRDSYSLLNWTRRMLAVRKQQKAFGRGSLRL
LAPANRRIFAYLREYHGADGSSETILCVANVSRSAQAVELELPQFADMVPVEMTGGSAFP
PIGQLPYLLTLPPYGFCWFLLAPASQMPSWHIKPTEGMPEFQTLVLRRLDDLLVDPNRRI
LEKEVLPAYLPKRRWFAGKGAPSGNVHIAYTVTFGNLPRPVLLSEIEVGGEGGPQRYQLP
LGFLPEEEFGSALPQQLAMTRVRRGRRVGLLTDAFTLEGFVRATVQALRERRVLAFEQGE
LRFLPTAQLDKVELPADAEVRYISAEQSNSSAVLGNALVLKLIRRVSVGVHPELEMGLHL
TGYGFANIASVLGEVCRVDAQGGCTVLMILQRYLENQGDAWEWTQNTLDRAIRDELAGGE
STLESQYSALHELESFSRQLGQRLGEMHMALAAPTEDPDFARETAGPEQAAQWTESIGAQ
LGRALEILAQRQATLAEEERAAVEQLLLQRDALLEKVGELAGACVGSLRIRVHGDLHLGQ
VLVVQGDAYLIDFEGEPSRPLAARRAKHSPYKDVSGVLRSIGYAADMAMRNAQSVDSSEA
ADQARRRIASLYQANARQAFLAAYRQAAAEIGHAWAVPDGEEAALALFSLEKTAYEIAYE
AENRPAWLAVPLRGLANLAQQLLDGEAQ
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatcgctcaagtccgtcgcctttctcgaggacccgttctggtacaaggacgcg
gtgatctaccaggtgcacgtcaagtcgttcttcgactcgaacaacgacggcatcggtgat
ttcccggggctgatcgccaagctggactacatcgccgacctgggggtcaacaccatctgg
ctgctgccgttctacccttcgccgcgtcgcgacgacggctacgacatcgccgaataccgc
ggcgtgcatccagactacggcagcctcgccgacgtgcgacgcctcatcgccgaggcgcac
cggcgcggcctgcggttgatcaccgaactggtgatcaaccacacctccgaccagcatccc
tggttccagcgggcgcggcaggccaggaagggctcggcggcgcgcaacttctacgtctgg
tcggatagcgacgacaagtaccgggacacccggatcatcttcctcgataccgagaagtcc
aactggacctgggacccggtggccggccagtacttctggcaccgcttctattcgcaccag
ccggatctcaacttcgacaacccgcaggtgatgaaggcggtgctcggcatcatgcgctac
tggctcgatctgggcgtcgacggtctgcgcctggacgccattccctacctgatcgagcgc
gacggcaccaataacgagaacctgcccgagacccaccaggtgctcaagcgcatccgcgcc
gagctggatgcccgctatccggaccgcatgctgctggccgaggccaaccagtggccggag
gacactcagctctacttcggcggcgccccggaggggaagggcgacgaatgccacatggcc
ttccacttcccgctgatgccgcgcatgtacatggccatcgcccaggaagaccgcttcccg
atgaccgacatcctgcgccagaccccggacatcccgtccgactgccagtgggcgatcttc
ctgcgcaaccacgacgaactgaccctggagatggtcaccgaccgcgagcgcgactacctg
tggaacttctacgccgccgaccgccgcgcgcggatcaacctggggatacgccggcgcctg
gcgccgctgctggagcgcgaccggcggcgcatcgaactgctcaacagcctgctgctgtcg
atgccaggtacgccggtgatctactacggcgacgagatcggcatgggcgacaacatctac
ctgggcgaccgcgacggggtgcgcacgcccatgcagtggagcaccgaccgcaacggcggc
ttttcccgcgccgatccggccggactggtgctgccgccgatcatggacccgctgtacggc
ttccagagcgtcaacgtcgaagcccagcagcgcgacagctactcgctgctcaactggacc
cggcgcatgctcgccgtacgcaagcagcagaaggccttcggccgcggctcgctgcggctg
ctggcgccggccaaccggcgcatcttcgcctacctgcgcgaataccatggcgcggacggc
agcagcgagaccatcctctgcgtggccaacgtctcgcgctcggcccaggcggtggaactg
gaactgccccagttcgccgacatggtgccggtggagatgaccggcggcagcgccttcccg
ccgatcggccagttgccctacctgctgaccctgccgccctacggcttctgctggttcctg
ctggcgcccgcgtcgcagatgcccagttggcacatcaagcccaccgaaggcatgccggaa
ttccagaccctggtgctgcggcgtctcgacgatctgctggtggaccccaaccggcgcatc
ctggagaaggaggtgttgccggcctacctgcccaagcgtcgttggttcgccggcaagggc
gcgccctcgggcaacgtgcacatcgcctatacggtgaccttcggcaatctgccgcgcccc
gtgctgctcagcgagatcgaggtcggcggcgagggcggcccgcagcgctaccagttgccg
ctgggttttctccccgaggaggagttcggcagcgccttgccccagcaactggccatgacc
cgggtgcgccgtggccggcgggtgggcctgttgaccgatgccttcaccctggagggcttc
gtccgcgcgacggtccaggcgctgcgcgagcgccgcgtgctggccttcgagcagggcgag
ctgcgctttctgcccaccgcgcaactggacaaggtcgagctgccggccgacgccgaggtg
cgctacatctccgccgagcaatccaacagctcggcggtgcttggcaacgccctggtgctc
aagctgatccgccgggtgtccgtcggcgtgcatcccgaactggagatgggcctgcacctc
accggatacggcttcgccaacatcgccagcgtgctcggcgaggtgtgtcgggtcgatgcc
cagggcggctgcaccgtgctgatgatcctgcagcgctacctggagaaccagggcgacgcc
tgggagtggacgcagaacaccctcgaccgggccatccgcgacgaactggccggcggcgag
tcgaccctggagagccagtacagcgcgctgcacgagctggagagcttttcccgccagctc
ggccagcgcctcggcgagatgcacatggccctggccgcgcccaccgaggacccggatttc
gctcgcgaaaccgccggtcccgagcaagcggcgcagtggaccgagagcatcggcgcgcaa
ctggggcgggccctggaaatcctcgcccagcgccaggcgacgctggccgaggaggaacgg
gccgccgtcgagcagttgctgctgcagcgtgatgccctgctggagaaagtcggcgaactg
gccggggcctgcgtcggcagcctgcgcatccgcgtgcatggcgatctgcacctcggccag
gtgctggtggtgcagggcgacgcctatctgatcgacttcgagggcgagccgtcgcggccg
ctcgccgcgcgccgcgccaagcacagcccttacaaggacgtcagcggcgtgctgcgctcg
atcggctacgccgccgacatggccatgcgcaacgcgcagagtgtcgacagctccgaggcg
gccgaccaggcccgtcggcgcatcgcctcgctgtaccaggcgaacgcccgccaggccttc
ctcgccgcctaccgccaggcggcggccgagatcggccatgcctgggccgtgccggacggc
gaggaggccgcgctggcgctgttcagcctggaaaagaccgcctacgaaatcgcctacgag
gccgaaaaccgccccgcctggctggccgtaccgctgcggggcctggcgaatctggcgcaa
cagctactggatggagaggcgcaatga

DBGET integrated database retrieval system