KEGG   Azotobacter vinelandii CA: AvCA_30580Help
Entry
AvCA_30580        CDS       T02633                                 

Gene name
lapF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00362  Benzoate degradation
avl00620  Pyruvate metabolism
avl00621  Dioxin degradation
avl00622  Xylene degradation
avl00650  Butanoate metabolism
avl01100  Metabolic pathways
avl01120  Microbial metabolism in diverse environments
avl01220  Degradation of aromatic compounds
Module
avl_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:avl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA_30580 (lapF)
   00650 Butanoate metabolism
    AvCA_30580 (lapF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA_30580 (lapF)
   00622 Xylene degradation
    AvCA_30580 (lapF)
   00621 Dioxin degradation
    AvCA_30580 (lapF)
Enzymes [BR:avl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AvCA_30580 (lapF)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     AvCA_30580 (lapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGK12633
Position
complement(3166951..3167865)
Genome map
AA seq 304 aa AA seqDB search
MKKIRCALIGSGNIGTDLIYKIRRSALLEPVWMVGIDPASEGLARARELGLKTTAEGVDG
LLPHVQEDDIQIAFDATSAYVHAENSRKLNALGVLVIDLTPAAIGPLCVPPVNLREHAAR
LEMNVNMISCAGQATIPVVHAVSRIQSVAYAEIVASLASKSIGPGTRANLDEFTYTTSGA
LEKVGGARRGKALAIINPAEPPMIMRNTISCLTDAEPDQERLSASILQMVGEVQKYVPGY
RLVNGPLYDGNGVSVFMEVAGLGDYLPTYAGNLDIMTAAATRTAEMFAEEILAGKIRLPT
PEVA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatccgttgcgccttgatcggctcgggcaacatcggcaccgacctgatctac
aagatccgccgcagcgcgctgctggagccggtgtggatggtcggcatcgaccccgcctcc
gaggggctggcgcgcgcccgcgagctgggtctgaagaccaccgccgagggtgtcgacggc
ctgctcccgcatgtgcaggaggacgacatccagatcgccttcgacgccaccagcgcctac
gtgcacgccgagaacagccgcaagctcaacgccctgggcgtgctggtgatcgacctgacc
ccggcagccatcggcccgttgtgcgtgccgccggtgaacctgcgcgagcacgccgccaga
ctggaaatgaacgtcaatatgatttcctgcgccgggcaggcgaccattccggtcgtccac
gcggtgtcgcgcatccagagcgtggcctatgccgagatcgtcgccagcctggcgtcgaaa
tccatcgggccgggcacccgcgccaacctcgacgagttcacctacaccacctccggcgcg
ctggagaaggttggcggcgcgcgccggggcaaggcgctggcgatcatcaatccggccgag
ccgccgatgatcatgcgcaacaccatctcctgcctgaccgacgcggaaccggaccaggaa
cgcctcagcgcctcgatcctgcagatggtcggcgaggtgcagaagtacgtgccgggctac
cggctggtcaacgggccgctctacgacggcaacggggtgtcggtgttcatggaagtggcc
ggcctcggcgactacctgccgacctacgccggcaacctcgacatcatgaccgcggcggcg
acccgcaccgccgagatgttcgccgaggaaatcctcgccggaaaaatccgcctgcccacc
ccggaggtcgcatga

DBGET integrated database retrieval system