KEGG   Azotobacter vinelandii CA: AvCA_39500Help
Entry
AvCA_39500        CDS       T02633                                 

Gene name
dsbC
Definition
Disulfide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
avl  Azotobacter vinelandii CA
Brite
Enzymes [BR:avl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AvCA_39500 (dsbC)
Secretion system [BR:avl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   AvCA_39500 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4000246..4000980)
Genome map
AA seq 244 aa AA seqDB search
MRVSSLFAAVALGLASTLALAADPGQAIRKALQQMQPGLPIESIAESPMTGLYQVQLKGG
RMLYASADGQFVMQGYLYQLKDGKPLNLTERAESLAVAKAINGIPAGEMVIFAPKEPKTH
ITVFTDTDCGYCQKLHSEVPELNRLGVEVRYVAFPRQGIGSHGYGDLVSVWCAKDRQAAM
NKAKAREKVPAATCDNPVAKQFELGQMIGVQGTPAVILANGQMIPGYQPAAQLAKQALTA
QSTN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtttcctcccttttcgctgccgtggcgctcggtttggcaagcactctggccttg
gcggccgatcccggccaggccattcgcaaggccctgcaacagatgcagccggggctgccg
atcgagtccatcgctgaaagcccgatgacggggctctaccaggtccagttgaaaggggga
cgaatgctctatgccagtgccgatggccagttcgtcatgcagggctatctgtatcagctc
aaggacggcaagccgctcaacctcaccgagagggcggaaagcctggccgtggcgaaggcc
atcaacggtataccggccggcgagatggtgatcttcgcgcccaaggagccgaagacccac
atcaccgtcttcaccgacaccgactgcggctactgccagaagctgcacagcgaggtgccg
gagctgaaccggctcggtgtcgaggtgcgctacgtggcctttccgcgccagggcatcggt
tcccacggctacggggatctggtgagtgtctggtgcgccaaggaccgccaggcggcgatg
aacaaggccaaggcgcgggagaaagtgccggcggccacctgcgacaacccggtcgccaag
caattcgagctgggtcagatgatcggcgtgcagggcactcccgccgtgatactggccaac
ggacagatgatccccggttatcagccggcggcgcagttggccaagcaggccctgaccgcc
cagtcgaccaactga

DBGET integrated database retrieval system