KEGG   Azotobacter vinelandii CA: AvCA_42130Help
Entry
AvCA_42130        CDS       T02633                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
avl  Azotobacter vinelandii CA
Pathway
avl00360  Phenylalanine metabolism
avl00362  Benzoate degradation
avl00620  Pyruvate metabolism
avl00621  Dioxin degradation
avl00622  Xylene degradation
avl00650  Butanoate metabolism
avl01100  Metabolic pathways
avl01120  Microbial metabolism in diverse environments
avl01220  Degradation of aromatic compounds
Module
avl_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:avl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AvCA_42130
   00650 Butanoate metabolism
    AvCA_42130
  Amino acid metabolism
   00360 Phenylalanine metabolism
    AvCA_42130
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AvCA_42130
   00622 Xylene degradation
    AvCA_42130
   00621 Dioxin degradation
    AvCA_42130
Enzymes [BR:avl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AvCA_42130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AGK12636
Position
complement(4241634..4242572)
Genome map
AA seq 312 aa AA seqDB search
MTKKLKVAIVGSGNIGTDLMIKILRHGQHLEMGALVGIDPNSDGLARAARLGVATTAEGV
EGLARLPGFGEIDFVFDATSAGAHVRNEAFLRALKPGLRLIDLTPAAIGPYCVPVVNLEQ
NLHETNVNMVTCGGQATIPMVAAVSRVARVHYAEIVASIASRSAGPGTRANIDEFTETTS
KAIEAIGGARKGKAIIVLNPAEPPLIMRDTVYVLSAPADRARVEASLAEMAQAVQGYVPG
YRLKQRVQFDEIPDAAPLNIPGLGRLSGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAALA
TAERMAQSMLNA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaactcaaagtcgccatcgtcggctccggcaacatcggcaccgacctgatg
atcaagatcctgcgccacggccagcacctggaaatgggcgccctggtcggcatcgacccg
aattccgacggcctggcccgcgccgcgcgcctcggcgtggccaccaccgccgagggcgtc
gagggcctggcccgcctgccggggttcggcgagatcgacttcgtcttcgacgccacttcg
gccggcgcccatgtgcgaaacgaggccttcctgcgcgcgctcaagcccggcctgcggctg
atcgacctgaccccggcggccatcggcccctactgcgtgccggtggtgaatctggagcag
aacctccacgaaaccaacgtcaacatggtcacctgcggcggccaggcgaccatccccatg
gtcgccgcggtgtcgcgggtggccagggtccactacgccgagatcgtcgcctcgatcgcc
agccggtcggccggccccggcacccgcgccaacatcgacgagttcaccgaaaccacctcg
aaggccatcgaggcgatcggcggggcgcgcaagggcaaggcgatcatcgtcctcaacccg
gccgagccgccgctgatcatgcgcgacaccgtctacgtgctctccgcgccggccgaccgg
gcgcgggtcgaggcctccctcgcggaaatggcccaggcggtacagggctacgtgccgggc
tatcgcctcaagcagcgggtgcagttcgacgagatccccgacgccgcgccgctgaacatc
cccggcctcggccgcctgtccggcctgaagacctcggtgttcctcgaggtcgagggcgcc
gcccattacctgccggcctacgccggcaacctggacatcatgacctccgccgcgctggcc
accgccgagcgcatggcgcaatccatgctgaacgcctga

DBGET integrated database retrieval system