KEGG   Azotobacter vinelandii CA: AvCA_51410Help
Entry
AvCA_51410        CDS       T02633                                 

Definition
Glycoside hydrolase, clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
avl  Azotobacter vinelandii CA
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:avl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:avl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:avl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5225473..5227674)
Genome map
AA seq 733 aa AA seqDB search
MTQAPITSPCIPEIETAGQGGGHPETLIRLDGTNATLLLIRRRAGLPEIAYWGRRLPQEI
SEAEIFAVRAPDSPNNGPDQWRPLITLLDTIGCWNFDMPGLIAARPDGSGWTANFETEQV
AQEGRRLVVRGKDTVSGLAIVLSLELGPDDVLTSQARLTNTGTQSLRVERLVSGTYLLPE
SVDTAHVLSGEWGNEFGIEPMNLTRGGIVVESRRNRAHDHFPGMLLSPASTSENEGEAWA
AQLGWSGGHRLCVERMEDGRIRLSCGEYLYSGEGDLAPGAELVTPVAYATYSSAGFSGCA
RAFQAHARRHLLHWPGGKMKPRPVLLNSWEGSGFDLHEDQLMRQVDAAAALGIERFVLDD
GWFGARRDCDAGLGDWFSAASVFPNGLRPLSDRIHGHGMEFGLWYEPEMVNPDSDLYRAH
PDWVLQTRGYPLWTSRNQLVLDISRPEVSNYLFEVISEQVASVRIDYIKWDFNRDLVEAS
DAQGRAAYRRQVLALYALWERLHKAHPGLEIESCASGGGRADWGALAHTQRVWTSDDTDA
LERLAIQGAAWHFLPPEVTGCHISEVPNGITGRTTTLDFRACVAIFGHLGVELDPTHLSA
EESTRLKAWIALHKRLRGLLHHGLAQFCTADPARVVRGVVSDDARSGVFLVAQRDWVSAR
RPSPIRLSGLDPAKTYRITLPEPQNLPGYRPSEAQKAVFSGKVPVSGATLMDVGVFPPFM
PPLSALVVELQAV
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagcacctatcacttctccatgcattccggaaatcgaaacggccggccaaggg
ggcggccatcctgaaacattgatccggctggatggtacgaacgctaccttattgctgatc
cgtcgccgggcggggttgccggaaatcgcgtattgggggcggcgcctgccgcaggaaatc
tcggaagccgagatcttcgccgtgcgtgccccggacagccccaataacgggccggaccag
tggcgcccgctgatcacgctgctcgatacgatcggctgctggaatttcgatatgcccggc
ctgatcgcggcgcgtcccgatggaagcggctggactgcgaatttcgagaccgagcaggtc
gcacaggagggccggcggctcgtggtacgggggaaggacaccgtatccgggcttgcgata
gtgctgagtctggaactcggacccgatgacgtgctgaccagccaggcgcggctgaccaat
accggcacgcagagcctgcgggtcgagcggcttgtctcggggacctatctgttgcccgag
tcggtcgataccgcgcatgtgctgtccggcgaatgggggaatgaattcggcatcgagccg
atgaacctgacccgtggcgggatcgtggtggagagccgccgcaaccgtgcgcacgatcac
ttccccggcatgctgctctcgccggccagcacctcggagaacgagggcgaagcctgggcc
gcacagcttggctggagcggcggtcatcgtctttgcgtggagcggatggaggacggacgc
atccgtttgtcatgcggcgaatatctctattcgggtgagggcgatctcgcgcctggcgcc
gagctggttacaccggttgcctatgccacctattcgtccgccgggttttccgggtgtgcc
cgagccttccaggcccatgcgcgtcgccaccttctgcactggccgggcggcaagatgaaa
ccgcgcccggtccttttgaactcctgggaggggagcgggttcgacctgcatgaggatcaa
ctgatgcgccaggtggacgcggcggccgcactcggcatcgaacggttcgtactggatgac
ggctggttcggggcacgacgcgattgcgatgccgggcttggcgactggttctccgccgct
tcggtttttccgaatggtctgcgtcccctgtccgacaggattcacgggcacggcatggag
ttcgggctctggtacgagccggagatggtcaatccggacagcgacctgtatcgcgcgcat
ccggactgggtgctgcagacgcgcggctaccctttgtggacgtcccgcaaccagttggtg
ctggatatttcgcggcccgaggtctcgaattacctgttcgaagtgatctccgagcaggtc
gccagcgtgcggatcgattacatcaagtgggatttcaatcgcgatctggtcgaggcatcc
gatgcgcaaggtcgcgcggcctaccgccgccaggtcctggcgctctatgcgctgtgggag
cggctgcacaaggcgcatcccggcctggagatcgaaagctgcgcatccggcggcggccgg
gctgactggggcgcgctggcacatacgcaacgcgtctggacttcggacgacaccgatgcg
ctggagcgtctcgcgatccagggcgcggcatggcatttcctgccgccggaggtgacgggc
tgccatatctcggaggttccgaatgggataaccggtcggacgacgacgctggatttccgg
gcgtgcgtggcgattttcgggcatctgggggtggaactggatccgacgcacctgtccgcc
gaggagtccacgcggctcaaggcgtggatcgcgctccacaagcggctgcgcggcctgctc
catcacgggctggcacagttctgcacggcggacccggcacgggtcgtgcgcggggtcgtc
tccgacgatgcacggtcgggggtcttcctggtagcccagcgcgactgggtttccgcccgc
aggccttcgcccatcaggctgagcggtctcgaccccgcgaaaacctatcgcatcacactc
cctgagccgcaaaacctgccagggtaccggccgtccgaggcgcaaaaagcggtattttcc
ggaaaagtcccggtcagcggagcgacattgatggatgtcggagttttcccgcctttcatg
ccgccattgtccgccctggtcgtggagttgcaggccgtataa

DBGET integrated database retrieval system