KEGG   Azotobacter vinelandii DJ: Avin_00880Help
Entry
Avin_00880        CDS       T00885                                 

Definition
Zinc-containing alcohol dehydrogenase superfamily protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Avin_00880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_00880
  Lipid metabolism
   00071 Fatty acid degradation
    Avin_00880
  Amino acid metabolism
   00350 Tyrosine metabolism
    Avin_00880
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Avin_00880
   00626 Naphthalene degradation
    Avin_00880
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Avin_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(88532..89515)
Genome map
AA seq 327 aa AA seqDB search
MRAMLLERVGHPLVLRELPTPQPGPGEVRVRVGACGVCRTDLHVVDGELPAVNPPVIPGH
EIVGRVDAVGPGVEGFALGQRVGIPWLGHTCGHCWYCRHEAENLCDAPQFTGYTRPGGYA
EQVVADARFTFALGEDGDDVALAPLLCAGLIGWRSLVKAGPARRLGLYGFGAAAHIVMQV
ARWQGREVYAFSRPGDLAAQDFARSLGAAWAGGSDQLPPEPLDAAILYAPAGELVPTALR
ALRKGGRVVCAGIHMSDIPSFPYDILWEEREVVSVANLTRQDGLDFFAVAEQAGIRTETH
RYALEDANRALDDLRHGRFQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatgctgctggaaagggtcggtcatcccctggtgctgcgcgagttgcccacc
ccgcagccgggaccgggcgaagtgcgcgtgcgggtcggcgcctgcggggtttgccgcacc
gacctgcatgtggtcgacggcgagctgccggcggtgaacccgccggtcatccccggccac
gagatcgtcggccgggtggacgccgtcggcccgggcgtcgagggcttcgcactcggccag
cgagtcggcatcccctggctgggacacacctgcgggcactgctggtactgccggcacgag
gcggagaacctctgcgacgcgccgcagttcaccggctacacccgccccggcggctacgcc
gaacaggtggtggccgacgcccgtttcaccttcgccctgggcgaggacggcgacgacgtg
gccctggcgccattgctctgcgccgggctgatcggctggcgctcgctggtcaaggcgggc
ccggccaggcgcctcggcctctacggcttcggcgcggcggcgcacatcgtcatgcaggtg
gcgcgctggcagggtcgcgaggtgtacgccttcagccggcccggcgacctcgccgcccag
gacttcgcccgctcgctcggcgcggcctgggccggcggctccgaccagttgccgccggag
ccgctggacgcggcgatcctctacgcgccggccggcgaactggtgcccaccgccctgcgc
gcgctgcgcaagggcggtcgggtggtctgcgccggcatccacatgagcgacatcccgagc
tttccctacgacatcctctgggaggaacgcgaggtggtgtcggtagccaacctgacccgc
caggacggcctcgacttcttcgccgtcgccgaacaggccggcatccgcacggaaacccac
cgctatgccctggaggatgccaaccgggcactggacgacctgcgtcacgggcgtttccaa
ggcgcggcggtgctggtgccctga

DBGET integrated database retrieval system