KEGG   Azotobacter vinelandii DJ: Avin_02120Help
Entry
Avin_02120        CDS       T00885                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta chain; TrypB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Avin_02120 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avin_02120 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avin_02120 (trpB)
Enzymes [BR:avn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Avin_02120 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
205981..207201
Genome map
AA seq 406 aa AA seqDB search
MTETSYRTGPDEKGLFGRFGGQYVAETLMPLILDLAEEYERAKVDPAFLEELAYFQRDYV
GRPSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKQRIIAETGA
GMHGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNE
ALRDWVTNVETTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLIEKEGRLPDSLVACIG
GGSNAMGLFHPFLDEPGVKIVGVEAAGHGIETGKHAASLNGGVPGVLHGNRTFLLQDADG
QIIDAHSISAGLDYPGIGPEHAWLHDIGRVEYSSITDHEALQAFHTCCRLEGIIPALESS
HALAEVFKRAPRLPKDHLMVVNLSGRGDKDMQTVMHHMQEKLEKHA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacttcctaccgcaccggccccgacgaaaaaggcctgttcggccgtttcggc
ggccagtacgtcgccgaaaccctgatgccgctgatcctcgacctggccgaggaatacgag
agggccaaggttgatccggccttcctcgaagaactggcctacttccagcgcgactacgtc
ggccggccgagcccgctgtatttcgccgagcgcctgaccgagcactgcggcggcgcgaag
atctacctcaagcgcgaagagctgaaccacaccggcgcgcacaagatcaacaactgcatc
gggcaaatcctgctggcccggcgcatgggcaagcagcgcatcatcgccgagaccggcgcc
ggcatgcacggcgtggccaccgccaccgtggccgcgcgcttcggcctgcagtgcgtgatc
tacatgggcaccaccgacatcgatcgccagcaggccaacgtcttccgcatgaagcttctt
ggcgccgaggtgatcccggtcaccgccggcaccggcaccctcaaggacgccatgaacgag
gccctgcgcgactgggtgaccaacgtcgagaccaccttctacctgatcggcaccgtggcc
ggcccgcatccgtacccggcgatggtccgcgatttccaggcggtgatcggcaaggaaacc
cgcgagcaactgatcgagaaggaagggcgcctgcccgactcgctggtcgcctgcatcggc
ggcggctccaacgccatgggcctgttccaccccttcctcgacgagccgggcgtgaagatc
gtcggcgtcgaggccgccggccacggcatcgagaccggcaagcacgcggccagcctgaac
ggcggcgtgcccggcgtgctgcacggcaaccgcaccttcctgctgcaggacgccgacggc
cagatcatcgacgcccactcgatctccgccggcctcgactaccccggcatcggcccggaa
catgcttggctacacgacatcggccgcgtcgagtacagctcgatcaccgaccatgaagcg
ctgcaggccttccatacctgctgtcgcctggagggcatcatcccggcgctggagtcgtcc
catgccctggccgaagtgttcaagcgcgcgccccggcttccgaaagaccacctgatggtg
gtcaacctctccggccgcggcgacaaggacatgcagaccgtgatgcatcacatgcaggaa
aaactggagaagcacgcatga

DBGET integrated database retrieval system