KEGG   Azotobacter vinelandii DJ: Avin_02130Help
Entry
Avin_02130        CDS       T00885                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:avn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:avn00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:avn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207198..208007
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFAELKQADRAALVTFVTAGDPDYETSLAILKGLPEAGADVIELGMPFTDPMAD
GPAIQLANIRALGAGQNLVKTLRMVRAFREGDRTTPLVLMGYFNPIHYYGVERFIAEARE
AGVDGLIVVDLPPEHNEDLCDPAQAAGLDFIRLTTPTTDDKRLPRVLAGSSGFVYYVSVA
GVTGAHAASLEHVEQAVARLRRHTDLPLCIGFGIRSPEHAGSVARLAEGVVVGSALVDRI
AKAGSKEQAVGDVLGLCRELAEGVRRARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgccgaactgaagcaagccgaccgcgccgccctggtc
accttcgtcaccgccggcgacccggactacgaaacctctctcgccatcctcaagggcctg
ccggaagccggcgccgacgtgatcgagctgggcatgcccttcaccgacccgatggccgac
ggcccggcgatccaactggccaacatccgcgccctcggcgccggccagaacctggtcaag
accctgcgtatggttcgcgccttccgcgaaggcgatcggaccaccccgctggtgctgatg
ggctacttcaaccccattcactactatggtgtcgaacgcttcatcgccgaggccagggag
gccggcgtcgatggtctgatcgtcgtcgacctgccgccggagcataacgaggacctctgc
gatccggcacaggcggcgggcctggacttcatccgcctgaccaccccgaccaccgacgac
aagcgcctgcccagggtgctcgccggcagctccggcttcgtctactacgtctcggtggcc
ggcgtcaccggcgcccacgccgcatccctggagcacgtcgaacaggctgtcgcccgcctg
cgccgtcacaccgacctgccgctgtgcatcggcttcggcatccgcagcccggaacacgcc
ggcagcgtcgcccgcctggccgagggcgtggtggtgggctcggcattggtcgaccgcatt
gccaaggccggctcgaaggagcaggcggtgggggatgtgttgggcttgtgtcgggagttg
gctgagggagttcggagggcgaggaggtaa

DBGET integrated database retrieval system