KEGG   Azotobacter vinelandii DJ: Avin_02130Help
Entry
Avin_02130        CDS       T00885                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha chain; TrpA
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Avin_02130 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Avin_02130 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Avin_02130 (trpA)
Enzymes [BR:avn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Avin_02130 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
207198..208007
Genome map
AA seq 269 aa AA seqDB search
MSRLQTRFAELKQADRAALVTFVTAGDPDYETSLAILKGLPEAGADVIELGMPFTDPMAD
GPAIQLANIRALGAGQNLVKTLRMVRAFREGDRTTPLVLMGYFNPIHYYGVERFIAEARE
AGVDGLIVVDLPPEHNEDLCDPAQAAGLDFIRLTTPTTDDKRLPRVLAGSSGFVYYVSVA
GVTGAHAASLEHVEQAVARLRRHTDLPLCIGFGIRSPEHAGSVARLAEGVVVGSALVDRI
AKAGSKEQAVGDVLGLCRELAEGVRRARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcagacccgcttcgccgaactgaagcaagccgaccgcgccgccctggtc
accttcgtcaccgccggcgacccggactacgaaacctctctcgccatcctcaagggcctg
ccggaagccggcgccgacgtgatcgagctgggcatgcccttcaccgacccgatggccgac
ggcccggcgatccaactggccaacatccgcgccctcggcgccggccagaacctggtcaag
accctgcgtatggttcgcgccttccgcgaaggcgatcggaccaccccgctggtgctgatg
ggctacttcaaccccattcactactatggtgtcgaacgcttcatcgccgaggccagggag
gccggcgtcgatggtctgatcgtcgtcgacctgccgccggagcataacgaggacctctgc
gatccggcacaggcggcgggcctggacttcatccgcctgaccaccccgaccaccgacgac
aagcgcctgcccagggtgctcgccggcagctccggcttcgtctactacgtctcggtggcc
ggcgtcaccggcgcccacgccgcatccctggagcacgtcgaacaggctgtcgcccgcctg
cgccgtcacaccgacctgccgctgtgcatcggcttcggcatccgcagcccggaacacgcc
ggcagcgtcgcccgcctggccgagggcgtggtggtgggctcggcattggtcgaccgcatt
gccaaggccggctcgaaggagcaggcggtgggggatgtgttgggcttgtgtcgggagttg
gctgagggagttcggagggcgaggaggtaa

DBGET integrated database retrieval system