KEGG   Azotobacter vinelandii DJ: Avin_07960Help
Entry
Avin_07960        CDS       T00885                                 

Definition
(GenBank) Zinc-containing alcohol dehydrogenase superfamily
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn00071  Fatty acid degradation
avn00350  Tyrosine metabolism
avn00625  Chloroalkane and chloroalkene degradation
avn00626  Naphthalene degradation
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_07960
  Lipid metabolism
   00071 Fatty acid degradation
    Avin_07960
  Amino acid metabolism
   00350 Tyrosine metabolism
    Avin_07960
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Avin_07960
   00626 Naphthalene degradation
    Avin_07960
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Avin_07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ACO77041
UniProt: C1DML1
Position
complement(752980..754008)
Genome map
AA seq 342 aa AA seqDB search
MAQTMKAAVVVEFGKPLEIREVPVPTPGPGQLLVKIAACGVCHTDLHAAEGDWPVKPEPP
FIPGHEGVGQVVAVGAGVGHVKEGDRVGIPWLHSSCGHCEHCLGGWETLCLAQSNTGYSV
NGGFAEYALADAEYVGHLPDNADFIEIAPILCAGVTVYKGLKMTDTRPGQWVAISGIGGL
GHMAVQYARAMGLNVAAVDVDDAKLELARRLGASLTVNARDQDPTAFLHKEIGGMHGVLV
TAVSPKAFEQALGMARRGGTVALNGLPPGEFSLSIFDMVLNGTTVRGSIVGTRLDLQEAL
DFAGQGKVRATVASEPLENINDIFARMHKGQIEGRIVLDLAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacgatgaaagcggccgttgtcgtcgaattcggcaaaccgctggaaattcgc
gaagtgccggtgcccacgcccggccccggacaactgctggtgaagatcgccgcctgcggc
gtctgccacaccgacctgcacgccgccgaaggcgactggccggtcaagcccgaaccgccg
ttcattcccggccacgagggcgtgggccaggtggtcgccgtgggcgccggtgtcggccac
gtcaaggaaggcgaccgggtcggcataccctggctgcactccagttgcggtcactgcgag
cactgcctgggcggctgggaaaccctctgcctggcgcagagcaataccggctactcggtg
aacggcggcttcgccgaatacgccctggccgatgccgagtacgtcggccacttgccggac
aacgccgacttcatcgagatcgcgcccatcctctgcgccggggtgaccgtctacaagggc
ttgaagatgaccgacacccggcccggccagtgggtggcgatctccgggatcggcggtctc
ggccatatggccgtgcagtacgccagggccatgggcctgaacgtcgccgccgtggacgtc
gacgacgccaagctggaactcgcccggcggctcggcgccagcctcacggtcaatgcccgc
gaccaggacccgacggccttcctgcacaaggaaatcggcggcatgcacggcgtgctggtc
accgccgtctcgccgaaggccttcgagcaggccctgggcatggcccgccgcggaggcacc
gtcgccctcaacggcctgccgcccggcgagttcagcctgtcgatcttcgacatggtgctc
aacggcaccacggtgcgtggctccatcgtcggcacccgcctggacctgcaggaagcgctg
gacttcgccggtcagggcaaggtccgcgccacggtcgccagcgaaccgctggagaacatc
aacgacatcttcgcccgcatgcacaaggggcagatcgaagggcgcatagtcctcgacctc
gccgcctga

DBGET integrated database retrieval system