KEGG   Azotobacter vinelandii DJ: Avin_10230Help
Entry
Avin_10230        CDS       T00885                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
avn  Azotobacter vinelandii DJ
Brite
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Avin_10230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
971161..972555
Genome map
AA seq 464 aa AA seqDB search
MKKLPLVIGACVAGYLATVFIVDRFDVRLSEQHLASAQLNGMDKLTSEAFKVLNSNGCQY
CHTRNSELPFYANMPIAKQLMNKDIELAQRQFNIESLLASAQQGKAVSEVDLAKIESVMQ
DNAMPPNLYLGMHWRSRLSDEEKGVLLDWVKAERLKQSSADAVADAYKYEPVQPITTSFP
VNPAKVALGEKLYHDTRLSSDDTVSCASCHALDKGGVDRLDVSVGVGGSKGPINAPTVYN
AAFNVLQFWDGRAADLQKQAGGPPMNPLEMASTSWEQIVGKLTQDAQLSAEFAALYPEGI
TENSITDAIAEFEKTLVTPNSRFDLFLKGQGDALSSVEKEGYELFKTAKCATCHVGEAMG
GQSFELMGIKKDYFADRGNVSEVDHGRYNVTKDPHDMYRFKVPTLRNVALTAPYFHDASA
KTLEDAVDKMAEYQVGMKLSKDEIGKIVAFLQTLNGEYQGKTLQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagctacccctcgtcattggagcctgcgtcgccggctacttggcaaccgtcttc
atcgtagaccgtttcgacgtgcgtctcagcgaacagcatctggccagtgcccaactgaac
ggcatggacaagctcacgagcgaagccttcaaggtgctgaacagcaatggttgccagtat
tgccatacccgcaacagcgagctgccgttctacgccaacatgccgatcgccaagcaactg
atgaacaaggacatcgagctggcccagcgccagttcaacatcgagtcgctgctggccagc
gcgcaacagggcaaggcggtctcggaagtggacctggccaagatcgagtcggtgatgcag
gacaacgccatgccgccgaacctctacctgggcatgcactggcggtcccggctgtccgac
gaggagaagggcgtgctgctcgactgggtgaaggccgagcgcctgaagcagagttcggcc
gatgcggtcgccgacgcctacaagtacgagccggtgcagccgatcaccaccagctttccg
gtgaacccggccaaggtcgcgctgggcgagaagctctaccacgatacccgcctgtccagc
gacgacaccgtctcctgcgccagttgccatgccctggacaagggcggggtggaccgcctg
gatgtttccgtcggggtcggcggctcgaaggggccgatcaacgcaccgacggtgtacaac
gccgccttcaacgtcctgcagttctgggacggccgcgcggccgacctgcagaagcaggcc
ggcggcccgccgatgaacccgctggagatggcttccacctcctgggagcagatcgtcggc
aagctgacgcaggacgcccagttgagcgccgagttcgccgccctctatccggaaggcatc
accgagaacagcatcaccgacgccatcgccgagttcgagaagaccctggtcacgccgaac
agccgcttcgacctgttcctgaaagggcagggcgacgctctcagcagcgtggagaaggaa
ggctacgaactgttcaagaccgccaagtgcgcgacctgccacgtgggcgaggcgatgggc
ggccagtccttcgaactgatgggcatcaagaaggattatttcgccgaccgcggcaatgtc
agcgaagtggaccacgggcgttacaacgtgaccaaggacccgcacgacatgtaccgcttc
aaggtgccgaccctgcgcaacgtcgcgctgaccgcgccctatttccacgacgccagcgcc
aagaccctggaggacgcggtcgacaagatggcggagtaccaggtcggcatgaaactgtcg
aaggacgagatcggcaagatcgtcgccttcctgcagaccctcaacggcgagtaccagggc
aagaccctgcagtga

DBGET integrated database retrieval system