KEGG   Azotobacter vinelandii DJ: Avin_10270Help
Entry
Avin_10270        CDS       T00885                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
avn  Azotobacter vinelandii DJ
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Avin_10270
   00670 One carbon pool by folate
    Avin_10270
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Avin_10270
    1.5.1.-  
     Avin_10270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(973783..974571)
Genome map
AA seq 262 aa AA seqDB search
MLRRWTHSPRLRESSMSASPAPILITGASQRIGLYCAERLLDEGQPVIATFRYERPGHER
PGLARLRERGVPTLQADFADEAGILAFIGRLKEHTDRLRAIVHNASEWLGETTPGEATPG
EEARIFQRLFNVHMLAPYLINLHCAELLERSSPADIVHIGDDVTRKGSARHIAYSASKAG
LDNLTLSFAARLAPRVKVNGIAPALILFKPEDDAEYRARTLAKSALGIEPGAEAVYLGLR
YLLDNPYVTGTTLTVNGGRHLK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtcgctggacccactctccccgactgcgcgagtcctccatgagtgcgtccccg
gctcccatcctgatcaccggcgccagccagcgcataggcctgtactgcgccgagcgcctg
ctcgacgagggccagccggtgatcgccaccttccgctacgaacggccgggccacgaacgg
ccgggcctcgcgcggctgcgcgaacgcggcgtgccgaccctgcaggcggacttcgccgac
gaggccggcatcctcgccttcatcgggcggctcaaggaacacaccgaccgcctgcgcgcc
atcgtgcacaacgcctcggagtggctgggcgagacgacgcccggcgaagcgacgcccggc
gaggaggcgcggatcttccagcgcctgttcaacgtacacatgctggcgccctacctgatc
aacctgcactgcgccgagttgctggaacgctccagcccggcggacatcgtgcatatcggc
gacgacgtgacacgcaagggcagcgcccggcacatcgcctacagcgccagcaaggccggc
ctcgacaacctcaccctgtccttcgccgcgcgcctggcgccgcgcgtcaaggtcaacggc
atcgcgccggcgctgatcctcttcaagccggaggacgatgccgaataccgcgccaggacc
ctggccaagtccgccctcggcatcgagcccggcgccgaggcggtctacctgggcctgcgc
tatctgttggacaatccctacgtcaccggcaccacgctgacggtcaacggcggccgtcac
ctcaagtga

DBGET integrated database retrieval system