KEGG   Azotobacter vinelandii DJ: Avin_10790Help
Entry
Avin_10790        CDS       T00885                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
avn  Azotobacter vinelandii DJ
Pathway
avn00010  Glycolysis / Gluconeogenesis
avn00020  Citrate cycle (TCA cycle)
avn00620  Pyruvate metabolism
avn01100  Metabolic pathways
avn01110  Biosynthesis of secondary metabolites
avn01120  Microbial metabolism in diverse environments
avn01130  Biosynthesis of antibiotics
avn01200  Carbon metabolism
Module
avn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_10790
   00020 Citrate cycle (TCA cycle)
    Avin_10790
   00620 Pyruvate metabolism
    Avin_10790
Enzymes [BR:avn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Avin_10790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACO77310
UniProt: C1DP78
Position
1026940..1028043
Genome map
AA seq 367 aa AA seqDB search
MKYFKLPDLGEGLQEAEIVEWHVKAGDSVKADQLLVSVETAKAIVDIPAPYDGVVAKTFG
GVGDLLHVGEPLIGYEGEGDAGTVVGRLEGGAEGQADSFCIGAAPSTREHLAPRATPAVR
QLAQKLGVELADLKGSGPDGLVTRADVEAAAEGARARFGGEKLRGVRRSMAINMARAHAE
VVPVTLFADADLHRWAQARDPMVRLAGAIAAACAAEPLLNAWFDGRSLSLRRHAQLDLGI
AVDTPDGLFVPVLRDVGARSAEDLKEGMARLRADVRARSIPPQEMMGATLTLSNYGTLFG
RYANPVVVPPQVAIVGAGAIRQEPVAVDGRVAVHPVLPLSLTFDHRAVTGGEAARFLKAL
VEALERP
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatttcaaactgcccgacctcggcgaaggtctgcaggaagccgagatcgtcgag
tggcacgtcaaggccggcgacagcgtgaaggccgaccagttgctggtttcggtggaaacc
gccaaggccatcgtcgatatcccggcgccctatgacggggtggtggccaagaccttcggc
ggggtgggcgatctgctgcacgtcggcgagccgctgatcggctacgaaggagagggcgac
gccggcaccgtggtcggccgtctggaaggcggcgccgagggacaggcggacagcttctgc
atcggcgccgcgccctcgacccgcgagcatctggcaccgcgggctaccccggcggtacgc
cagttggcgcagaaactgggcgtcgagctggccgatctgaagggctccggcccggacggg
ctggtcacccgcgccgacgtggaggccgccgcggagggcgcgcgcgcgcgcttcggtggc
gagaagctgcgcggcgtgcggcgcagcatggcgatcaacatggcccgcgcgcatgccgag
gtggtgccggtgaccctgttcgccgacgccgacctgcatcgctgggcgcaggcccgcgac
cccatggtgcgcctggccggggccatcgccgccgcctgcgccgccgaaccgctgctcaac
gcctggttcgacggcaggagcctgtcgctgcgccggcacgcacagctcgacctgggcatc
gccgtggacaccccggacggtctcttcgtgccggtgctgcgcgacgttggtgcgcgtagc
gcggaggatctgaaggagggcatggccagactgcgcgccgacgtgcgggcgcgctccatt
ccgccgcaggagatgatgggcgcgaccctcaccctgtcgaactacggcaccctgttcggg
cgctacgccaatcccgtagtggtgccgccgcaggtagccatcgtcggcgccggcgccatc
cgccaggaaccggtggcggtggacggccgggtggccgtgcatccggtgctgccgctgtcc
ttgaccttcgaccaccgcgcggtcaccggcggcgaagcggcgcgttttctcaaggcgctg
gtcgaggcgctggaacggccgtag

DBGET integrated database retrieval system