KEGG   Azotobacter vinelandii DJ: Avin_12910Help
Entry
Avin_12910        CDS       T00885                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:avn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:avn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1254172..1255437
Genome map
AA seq 421 aa AA seqDB search
MDKLIITGGHRLDGEIRISGAKNAALPILAATLLADTPVTVCNLPHLHDITTMIELFGRM
GVQPVIDEKLSVEMDASSIKTLVAPYELVKTMRASILVLGPMLARFGEAEVALPGGCAIG
SRPVDLHIRGLEALGAQIEMDGGYIKARAPAGGLRGGHFFFDIVSVTGTENIMMAAALAS
GRTVLENAAREPEVVDLANFLIGMGAQIKGAGTDTVVIEGVKRLGGGRYSVMPDRIETGT
YLVAAVATRGRVKLKDTDPTILEAVLLKLEEAGAQIDTGNNWISLDMKGNRPKAVNVRTA
PYPAFPTDMQAQFISMNAVAEGTGTVIETVFENRFMHVYEMNRMGARILVEGNTAIVTGV
PCLKGAPVMATDLRASASLVIAGLVAEGDTLIDRIYHIDRGYECIEEKLQLLGAKIRRIP
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactgatcattaccggcggtcatcgtctcgatggcgagatccgtatctctgga
gcgaagaacgcggccttgcccattctggcggcgaccctgctggccgacactcccgttacc
gtctgcaacctgccgcacctgcacgacatcaccacgatgatcgagcttttcgggcgcatg
ggggtgcagcccgtgatcgacgaaaagctcagcgtcgaaatggacgccagcagcatcaag
acgctggtggcgccttacgaactggtcaagaccatgcgtgcctcgatcctggtgctcggc
cccatgctggcgcgcttcggcgaggccgaggtggctctgccgggaggctgtgccattggt
tcgcggccggtcgatctgcatatccgtggtctcgaggcactgggtgcacagatcgaaatg
gatggcggctacatcaaggccagggctccggccggcggtctacgtggcggtcatttcttt
ttcgatatcgtcagcgtgaccggtaccgagaacatcatgatggctgcggcgctggccagc
gggcgtaccgtgctggagaatgccgctcgcgagcctgaagtggtcgacctggccaacttt
ctgatcggcatgggcgcccagatcaagggcgccggcaccgacaccgtcgttatcgaaggc
gtcaaacgcctaggcggcggccgttacagcgtgatgcccgaccgtatcgaaaccgggacc
tacctcgtggccgctgttgccacccgtggccgggtcaagctcaaggataccgatcccacc
attctcgaggcggtactgctcaagctggaggaggcgggggcacagatcgataccggcaac
aactggatttccttggacatgaagggaaacaggcccaaggccgtgaacgtacgcaccgcg
ccttatcctgctttcccgaccgacatgcaggctcagttcatttccatgaacgcggtggcc
gaaggtactggcaccgtcatcgaaacggtattcgagaaccgcttcatgcacgtctacgag
atgaatcgcatgggcgcgcgcattctggtggagggcaacaccgccatcgtcacaggcgtg
ccctgcctgaagggggctcctgtcatggctaccgacctgcgtgcctccgccagtctggtg
atcgccgggctggtagcggaaggggataccctgatcgatcgcatctaccatatcgaccgc
ggttacgaatgcatcgaggaaaagctgcaactgctcggtgccaagatccgtcgcattccg
ggctag

DBGET integrated database retrieval system