KEGG   Azotobacter vinelandii DJ: Avin_13200Help
Entry
Avin_13200        CDS       T00885                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Avin_13200 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Avin_13200 (murE)
Enzymes [BR:avn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Avin_13200 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282485..1283948
Genome map
AA seq 487 aa AA seqDB search
MPMPLNQLLPQAETALLIRELTLDSRQVRPGDLFLAVPGGRQDGRAHIPDALARGAAAVA
YEAAGAPSFADGGVPLVPIKGLAGQLSAIAGRFYGEPSRALCLVGVTGTNGKTSVSQLLA
QALDLLGERCGIIGTLGNGFHGALQSGRHTTPDPISVQAALAGLKQAGARAVSMEVSSHA
LAQGRVSALDFDVAIFTNLSRDHLDYHGSMDAYGAAKARLFAWPGLRCRVLNLDDPFGRL
LAGEANASRLIGYSLESRSAQVHCRRAHFDEQGVRAEVATPQGEGLLHSPLLGRFNLSNL
LAVVGALLGLDYALDEILRVVPQLQAPAGRMQRLGGGAKPLVVVDYAHTPDALEKVLEAL
RPHVRGRLLCLFGCGGDRDRGKRPLMAAVAERLADALLITDDNPRSESPEQIFADIRSGI
GVPEKVTCLHGRGQAIARLIAGADASDVLLLAGKGHEDYQEINGVRQPFSDIEEAAKALY
AWEVAHA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgccgctcaatcagttgctgccacaggccgagacggcgctactgatccgggag
ttgaccctggacagccgccaggtgcgtccgggggacctctttctcgcggttccggggggc
cggcaggatggccgcgcccatatcccggatgcgcttgcccggggggcggcggccgtggcc
tacgaggccgcgggggcgccatcgttcgctgacggtggtgtaccgttggttccaatcaaa
gggctggccgggcagttgtcggcaattgccggccgcttctatggcgagccgagccgagcc
ttgtgtctggtcggtgtgaccgggaccaacggcaagaccagcgtcagccaactactcgcc
caggccctggatttgctcggggagcgctgcggcatcatcggtaccctgggcaatggtttt
catggcgcgttgcagagtggtcgccacaccacgcccgacccgatcagcgtgcaggcggct
ttggcgggattgaagcaggccggtgcccgtgcggtatccatggaagtgtcttcccatgcg
ctcgcgcagggccgtgtgtcggcgctggacttcgatgtggcgattttcaccaatctgtcg
cgcgaccatctcgactaccacggcagcatggatgcctatggtgcggccaaggcccggctg
ttcgcctggcccgggctgcgctgccgggtgctcaatctggacgatcccttcggtcggctc
ctggctggggaggcgaatgcatcccgcctgatcggttacagcctggagagtcgctctgcc
caggtgcactgtcgccgtgcgcatttcgacgagcagggggtacgggccgaggtggcgacc
ccgcaaggtgagggattgctgcacagcccgctgctggggcgtttcaatctgagcaacctg
ttggcggtggtcggggcactgctggggctggactacgcactggacgaaattctccgcgtc
gtgccgcaattgcaggctccggccggacgcatgcagcggctggggggaggcgccaagccg
ctggtcgtggtggattatgcccataccccggatgccttggagaaggttctggaggcgctg
cgtccccatgtccgcgggcgcctgctgtgcctgttcggctgcggcggcgatcgtgatcgc
ggcaagcgtccgctgatggcggcggtcgccgagcgcctggccgatgcgctgctgattact
gacgacaaccctcgcagcgagtctccggagcagattttcgccgatatccgcagcggtatc
ggtgtaccggaaaaggttacctgcctgcatggacgtggccaggccatcgcccgcctgatc
gccggtgccgacgcgagcgacgtgctgttgctggccggcaaggggcatgaggactaccag
gaaatcaatggcgtgcgtcagcctttttccgacatcgaggaggccgccaaggccctgtac
gcctgggaagtagctcatgcttaa

DBGET integrated database retrieval system