KEGG   Azotobacter vinelandii DJ: Avin_14580Help
Entry
Avin_14580        CDS       T00885                                 

Gene name
gapB
Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avin_14580 (gapB)
   01230 Biosynthesis of amino acids
    Avin_14580 (gapB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_14580 (gapB)
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Avin_14580 (gapB)
Exosome [BR:avn04147]
 Exosomal proteins
  Proteins found in most exosomes
   Avin_14580 (gapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439606..1440991
Genome map
AA seq 461 aa AA seqDB search
MIPLIGQLYRNNNVVTSIFGRPLINQSVIAVLKAHRFARHRQTDEAELSVHETFPILKAM
SELKLGAASVDLGKMVGKYREAGAGRSVEQFVRDELSEVVGRQNSIQHKGSDVVLYGFGR
IGRLLARILIQKTGGGDGLRLRAIVVRKGADNDLAKRASLLRRDSVHGPFEGTITVDEES
NTILANGNLIQVIYSNDPTSVDYTQYGIQSAIVVDNTGKWRDAEGLGQHLKCPGVARVVL
TAPGKGALKNIVHGINHRDITDEDKIVSAASCTTNAIVPVLKAVNDKFGIVNGHVETVHS
YTNDQNLIDNFHKGSRRGRSAPLNMVITETGAATAAAKALPELKGKLTGNAIRVPTPNVS
MAILNLNLEKSTSRDEINEYLRQVAMFSELHKQIDFVNSSEVVSTDFVGSRHAGVVDAEA
TICTDNRVVLYVWYDNEFGYSCQVVRVLEEIAGVNPPVFPN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgatcggtcagctctatcgcaacaacaacgtggtgacctcgattttcgga
cgtcccctgatcaaccagtccgtgatcgcggtcctcaaggcccatcgcttcgcccgccac
cgccagaccgacgaggccgagctttcggtgcacgagaccttcccgatcctcaaggccatg
agcgagctgaagctcggcgccgcttccgtcgatctgggcaagatggtcggcaagtaccgg
gaggccggtgccggtcgctccgtcgagcagttcgtgcgcgacgagctgtccgaggtcgtc
ggcaggcagaacagcatccagcacaagggcagcgacgtggtgctctatggcttcggccgc
atcggccgcctgctggcgcgcatcctgatccagaagaccggcggcggcgacggactgcgc
ctgcgcgccatcgtcgtgcgcaagggcgccgacaacgatctggccaagcgcgccagcctg
ttgcgccgtgactcggtgcacggcccgttcgaaggcaccatcaccgtggacgaggaaagc
aataccatcctcgccaacggcaacctgatccaggtgatctactccaacgacccgacctcc
gtcgattacacccagtacggcatccagagcgccatcgtggtcgacaacaccggcaagtgg
cgcgacgccgaaggcctcggccagcatctgaagtgcccgggcgtcgcccgcgtggtactg
accgctccgggcaagggggcgctgaagaacatcgtgcatggcatcaaccatcgcgacatc
accgacgaggacaagatcgtctccgcggcttcctgcaccaccaatgccatcgtgccggtg
ctgaaggcggtgaacgacaagttcggcatcgtcaatggtcacgtggagaccgtgcactcc
tacaccaacgaccagaacctgatcgacaacttccacaagggcagccgccgcggtcgaagc
gctccgctgaacatggtgatcaccgagaccggggcggccaccgccgcggccaaggccctg
cccgagttgaagggcaagctgaccggcaacgcgattcgcgtgccgacgccgaacgtttcc
atggcgatcctcaacctgaacctggaaaagtccaccagccgcgacgagatcaacgaatac
ctgcgtcaggtggcgatgttctccgaactgcacaagcagatcgacttcgtcaactcgtcc
gaggtggtatccaccgacttcgtcggttcccgccatgccggggtggtggatgccgaagcc
accatctgcaccgacaatcgagtcgtgctctatgtctggtacgacaacgagttcggctac
agttgccaggtggtacgcgtgctcgaggaaatagccggagtcaatccgccggttttcccc
aactga

DBGET integrated database retrieval system