KEGG   Azotobacter vinelandii DJ: Avin_14580Help
Entry
Avin_14580        CDS       T00885                                 

Gene name
gapB
Definition
glyceraldehyde-3-phosphate dehydrogenase
Orthology
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Class
Metabolism; Overview; Carbon metabolism [PATH:avn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:avn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:avn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439606..1440991
Genome map
AA seq 461 aa AA seqDB search
MIPLIGQLYRNNNVVTSIFGRPLINQSVIAVLKAHRFARHRQTDEAELSVHETFPILKAM
SELKLGAASVDLGKMVGKYREAGAGRSVEQFVRDELSEVVGRQNSIQHKGSDVVLYGFGR
IGRLLARILIQKTGGGDGLRLRAIVVRKGADNDLAKRASLLRRDSVHGPFEGTITVDEES
NTILANGNLIQVIYSNDPTSVDYTQYGIQSAIVVDNTGKWRDAEGLGQHLKCPGVARVVL
TAPGKGALKNIVHGINHRDITDEDKIVSAASCTTNAIVPVLKAVNDKFGIVNGHVETVHS
YTNDQNLIDNFHKGSRRGRSAPLNMVITETGAATAAAKALPELKGKLTGNAIRVPTPNVS
MAILNLNLEKSTSRDEINEYLRQVAMFSELHKQIDFVNSSEVVSTDFVGSRHAGVVDAEA
TICTDNRVVLYVWYDNEFGYSCQVVRVLEEIAGVNPPVFPN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgctgatcggtcagctctatcgcaacaacaacgtggtgacctcgattttcgga
cgtcccctgatcaaccagtccgtgatcgcggtcctcaaggcccatcgcttcgcccgccac
cgccagaccgacgaggccgagctttcggtgcacgagaccttcccgatcctcaaggccatg
agcgagctgaagctcggcgccgcttccgtcgatctgggcaagatggtcggcaagtaccgg
gaggccggtgccggtcgctccgtcgagcagttcgtgcgcgacgagctgtccgaggtcgtc
ggcaggcagaacagcatccagcacaagggcagcgacgtggtgctctatggcttcggccgc
atcggccgcctgctggcgcgcatcctgatccagaagaccggcggcggcgacggactgcgc
ctgcgcgccatcgtcgtgcgcaagggcgccgacaacgatctggccaagcgcgccagcctg
ttgcgccgtgactcggtgcacggcccgttcgaaggcaccatcaccgtggacgaggaaagc
aataccatcctcgccaacggcaacctgatccaggtgatctactccaacgacccgacctcc
gtcgattacacccagtacggcatccagagcgccatcgtggtcgacaacaccggcaagtgg
cgcgacgccgaaggcctcggccagcatctgaagtgcccgggcgtcgcccgcgtggtactg
accgctccgggcaagggggcgctgaagaacatcgtgcatggcatcaaccatcgcgacatc
accgacgaggacaagatcgtctccgcggcttcctgcaccaccaatgccatcgtgccggtg
ctgaaggcggtgaacgacaagttcggcatcgtcaatggtcacgtggagaccgtgcactcc
tacaccaacgaccagaacctgatcgacaacttccacaagggcagccgccgcggtcgaagc
gctccgctgaacatggtgatcaccgagaccggggcggccaccgccgcggccaaggccctg
cccgagttgaagggcaagctgaccggcaacgcgattcgcgtgccgacgccgaacgtttcc
atggcgatcctcaacctgaacctggaaaagtccaccagccgcgacgagatcaacgaatac
ctgcgtcaggtggcgatgttctccgaactgcacaagcagatcgacttcgtcaactcgtcc
gaggtggtatccaccgacttcgtcggttcccgccatgccggggtggtggatgccgaagcc
accatctgcaccgacaatcgagtcgtgctctatgtctggtacgacaacgagttcggctac
agttgccaggtggtacgcgtgctcgaggaaatagccggagtcaatccgccggttttcccc
aactga

DBGET integrated database retrieval system