KEGG   Azotobacter vinelandii DJ: Avin_15690Help
Entry
Avin_15690        CDS       T00885                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Avin_15690 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Avin_15690 (glk)
   00052 Galactose metabolism
    Avin_15690 (glk)
   00500 Starch and sucrose metabolism
    Avin_15690 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Avin_15690 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Avin_15690 (glk)
   00524 Butirosin and neomycin biosynthesis
    Avin_15690 (glk)
Enzymes [BR:avn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Avin_15690 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1539849..1540817
Genome map
AA seq 322 aa AA seqDB search
MKLALIADIGGTHVRFALWRDGRPQALRVLATGDYPGPEEAIRAYLAALELPLAALETAC
LACAGPVHGDRFSLTNNHWRFGRLALTHALGLRQLLVINDFAAMALGMTRLAEHERLTIR
PGQAAVGSPRLVLGPGTGLGVSALLPDGPGNWRVLPGEGGHVDLPLGNSREVALWQLLQR
DLGHVSAESVLCGSGLLRLYRVSCRLDGQQPRLDSAAAVSAAALAGEAGAMAVLEQFCCW
LGRVAGNHALTLGARGGVYLAGGILPHFAAFLRDSGFSRCFVDKGVMSGYLQDIPVWLAV
AEQPGLLGAGLALDAWAKRQPA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggccctgatcgccgacatcggcggaacccacgtacgtttcgccctctggcgg
gacggccggccgcaggcgctgcgagtgctggccacgggcgactatcccggccccgaggag
gcgatccgcgcctacctcgccgcgctggaattaccgctggcggcgctggagacggcctgc
ctggcctgtgccggtcccgtgcatggcgatcggttcagcctgaccaacaatcactggcgg
ttcggccgcctggcgctcacccatgcgctgggtctgcgccagttgctggtgatcaacgac
ttcgccgccatggccctcggcatgacccgcctggccgagcacgagcggctgaccatccgg
ccggggcaggctgccgtcggcagcccccggctggtgctggggccgggcaccgggctcggt
gtcagcgccctgctgccggatggtccgggaaactggcgggtgctgccgggcgagggcggg
catgtcgatctgccgctcggcaattcgcgcgaggtggcgttgtggcagttgctgcagcgc
gatctcggccacgtttccgcggagagcgtgctctgcggcagcggcctgctgcggctgtac
cgcgtcagttgcaggctcgacggacagcagccgcgactcgactcggccgctgcggtgagc
gccgcggcattggccggcgaggccggcgcgatggcggtgctggagcagttctgctgctgg
ctgggacgggtcgccggcaaccatgcgctgaccctgggggcgcgcggcggcgtttatctg
gccggtggcatcctgccgcatttcgccgctttcctgcgcgacagcggcttctcccgctgc
ttcgtcgacaagggggtgatgagcggctatctgcaggacatcccggtatggctggcggtg
gccgagcagcccggcctgctgggcgccgggctggcgctggacgcctgggcgaagcgccag
cccgcctga

DBGET integrated database retrieval system