KEGG   Azotobacter vinelandii DJ: Avin_17590Help
Entry
Avin_17590        CDS       T00885                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:avn00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:avn00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1742407..1743180)
Genome map
AA seq 257 aa AA seqDB search
MTILSGKTALVTGSTSGIGLGIAHCLAAAGANLVLNGFGDAQQALEAVRQHGHEARHHPA
DMSKPEEIAALMAFAESEFGAVDILVNNAGIQHVAPVEEFPPERWDSILAINLSSAFHTT
RLALPGMRRRDWGRIVNIASVHGLVASAQKSAYVAAKHGLLGLTKVVALETAQTPITCNA
ICPGWVLTPLVQQQIDARVQAGGDPAAARHDLLAEKQPSLEFVTPEQLGALVLFLCSDAA
SQVRGAAWNMDGGWAAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcctcagcggcaagaccgccctggtcaccggctccaccagcggcatcggcctc
ggcatcgcccactgcctggccgccgccggcgccaacctggtgctcaacggcttcggcgac
gcgcagcaggcgctggaggcggtacgccagcacggccacgaagcgcgccaccatccggcg
gacatgtccaagccggaggaaatcgccgcgctgatggccttcgccgagagcgagttcggc
gccgtcgacatcctggtcaacaacgccggcatccagcacgtggcgccggtcgaggaattc
ccgccggagcgctgggacagcatcctcgccatcaacctctcctcggccttccacaccacc
cgcctggccctgccgggcatgcgccggcgcgactgggggcggatcgtcaacatcgcctcg
gtgcacggcctggtcgcctcggcgcagaagtccgcctacgtcgccgccaagcacgggctg
ctcggcctgaccaaggtggtcgccctggaaaccgcgcagacccccatcacctgcaacgcg
atctgtccgggctgggtgctgacgccgctggtgcagcagcagatcgacgcccgcgtccag
gccggcggcgatcccgccgccgcccgtcacgacctgctggccgagaaacagccgtcgctg
gaattcgtcacccccgagcagctcggcgcgctggtgctgttcctgtgcagcgacgcggcc
agccaggtgcgcggcgcggcctggaacatggatggcggctgggcggcgcaatga

DBGET integrated database retrieval system