KEGG   Azotobacter vinelandii DJ: Avin_17590Help
Entry
Avin_17590        CDS       T00885                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
avn  Azotobacter vinelandii DJ
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:avn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Avin_17590
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Avin_17590
Enzymes [BR:avn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Avin_17590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1742407..1743180)
Genome map
AA seq 257 aa AA seqDB search
MTILSGKTALVTGSTSGIGLGIAHCLAAAGANLVLNGFGDAQQALEAVRQHGHEARHHPA
DMSKPEEIAALMAFAESEFGAVDILVNNAGIQHVAPVEEFPPERWDSILAINLSSAFHTT
RLALPGMRRRDWGRIVNIASVHGLVASAQKSAYVAAKHGLLGLTKVVALETAQTPITCNA
ICPGWVLTPLVQQQIDARVQAGGDPAAARHDLLAEKQPSLEFVTPEQLGALVLFLCSDAA
SQVRGAAWNMDGGWAAQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcctcagcggcaagaccgccctggtcaccggctccaccagcggcatcggcctc
ggcatcgcccactgcctggccgccgccggcgccaacctggtgctcaacggcttcggcgac
gcgcagcaggcgctggaggcggtacgccagcacggccacgaagcgcgccaccatccggcg
gacatgtccaagccggaggaaatcgccgcgctgatggccttcgccgagagcgagttcggc
gccgtcgacatcctggtcaacaacgccggcatccagcacgtggcgccggtcgaggaattc
ccgccggagcgctgggacagcatcctcgccatcaacctctcctcggccttccacaccacc
cgcctggccctgccgggcatgcgccggcgcgactgggggcggatcgtcaacatcgcctcg
gtgcacggcctggtcgcctcggcgcagaagtccgcctacgtcgccgccaagcacgggctg
ctcggcctgaccaaggtggtcgccctggaaaccgcgcagacccccatcacctgcaacgcg
atctgtccgggctgggtgctgacgccgctggtgcagcagcagatcgacgcccgcgtccag
gccggcggcgatcccgccgccgcccgtcacgacctgctggccgagaaacagccgtcgctg
gaattcgtcacccccgagcagctcggcgcgctggtgctgttcctgtgcagcgacgcggcc
agccaggtgcgcggcgcggcctggaacatggatggcggctgggcggcgcaatga

DBGET integrated database retrieval system